![Open Access](/resources/images/iconopenaccess.png)
TAT‑fused IP3R‑derived peptide enhances cisplatin sensitivity of ovarian cancer cells by increasing ER Ca2+ release
- Authors:
- Published online on: November 16, 2017 https://doi.org/10.3892/ijmm.2017.3260
- Pages: 809-817
-
Copyright: © Xie et al. This is an open access article distributed under the terms of Creative Commons Attribution License.
Abstract
Introduction
Ovarian cancer is the most common form of gynecological cancer and is a serious threat to women's health and survival worldwide. Cis-diammine-dichloroplatinum (II), also known as cisplatin, is a classic chemotherapy drug that is widely used for the treatment of advanced cancers, including ovarian cancer (1,2). Cisplatin exhibits a satisfactory therapeutic effect during the early stages of administration; however, patients often become resistant to cisplatin during long-term administration. It has previously been reported that overexpression of the anti-apoptotic B-cell lymphoma 2 (Bcl-2) protein facilitates the pathophysiology and cisplatin resistance of cancer by inhibiting apoptosis (3). Bcl-2 contains BH1, BH2, BH3 and BH4 domains. Bcl-2 has been reported to bind to Bcl-2-associated X protein (Bax)/Bcl-2 homologous antagonist killer via its BH3 domain and inhibit cytochrome c release from the mitochondria, thus maintaining mitochondrial integrity. Notably, BH3-mimetic Bcl-2 inhibitors have attracted much attention and have been extensively studied (4). The BH3-mimetics ABT737 and ABT-263 have been reported to enhance cisplatin sensitivity in cholangiocarcinoma and ovarian carcinoma cells (5,6). However, the function of the Bcl-2 BH4 domain in ovarian carcinoma cells remains unclear.
Bcl-2 has been reported to induce a reduction in endoplasmic reticulum (ER) Ca2+ load and release via its BH4 domain (7). The ER is the main store of intracellular Ca2+ and a crucial organelle in eukaryotic cells. A large release of Ca2+ from the ER can activate calpain-1, which is a Ca2+-dependent cysteine protease responsible for the transition from caspase-4 to cleaved caspase-4, which in turn activates ER stress-induced apoptosis (8). Furthermore, Ca2+ release from the ER can enhance mitochondrial Ca2+ uptake, which is accompanied by a release of cytochrome c and activation of the mitochondrial apoptotic pathway (9). In our previous study, it was demonstrated that the expression of Bcl-2 was higher in cisplatin-resistant SKOV3/DDP ovarian cancer cells compared with in cisplatin-sensitive SKOV3 ovarian cancer cells (10). A low dose of cisplatin induced apoptosis, which was accompanied by cytoplasmic and mitochondrial Ca2+ overload in SKOV3 cells, but not in SKOV3/DDP cells (11). These results suggested that Bcl-2 contributes to cisplatin resistance in ovarian cancer by inhibiting ER Ca2+ release.
Bcl-2 inhibits ER Ca2+ release by directly binding and inhibiting the inositol 1,4,5-trisphosphate receptor (IP3R), which is the main ER Ca2+ release channel, via its BH4 domain. IP3R transmits signals between the cytoplasm and ER microenvironment, and can modulate the mitochondrial Ca2+ signal (12). By deleting the BH4 domain, Liu et al demonstrated that the BH4 domain was important for the prosurvival activity of Bcl-2 (13). Stabilized TAT-fused IP3R-derived peptide (TAT-IDPS) can specifically target the BH4 domain of Bcl-2 and reverse Bcl-2-mediated inhibition of IP3-induced Ca2+ elevation, ultimately increasing Ca2+-dependent cell apoptosis (14). TAT-IDPS has been reported to induce apoptosis of diffuse large B-cell lymphoma cells by promoting IP3-induced proapoptotic Ca2+ signaling (14). These results indicated that targeting the BH4 domain may induce conversion of Bcl-2 from a prosurvival protein into a proapoptotic protein. Notably, Zhong et al indicated that TAT-IDPS sensitivity is positively correlated with Bcl-2 expression (15). Therefore, it may be hypothesized that TAT-IDPS increases the sensitivity of cells to cisplatin via IP3-dependent Ca2+ release in SKOV3/DDP cells.
The present study aimed to evaluate the effects of TAT-IDPS on the cytotoxicity of cisplatin in SKOV3/DDP cells. The results demonstrated that TAT-IDPS increased cisplatin-induced apoptosis by increasing Ca2+ release from the ER to the cytoplasm and mitochondria. These experimental results indicated that TAT-IDPS, combined with chemotherapy, may be considered a viable treatment strategy for the prevention and treatment of ovarian cancer.
Materials and methods
Antibodies and drugs
Anti-caspase-3 (sc-7272), anti-caspase-4 (sc-56056) and anti-cleaved caspase-4 (sc-22173-R) antibodies (Abs) were purchased from Santa Cruz Biotechnology, Inc. (Dallas, TX, USA). Anti-cleaved caspase-3 (ab2302), anti-protein disulfide isomerase (PDI; ab2792) and anti-CCAAT-enhancer-binding protein homologous protein (CHOP; ab11419) Abs were purchased from Abcam (Hong Kong) Ltd. (Hong Kong, China). Anti-β-actin (60008–1-Ig), anti-Bcl-2-associated X protein (Bax; 50599-2-Ig), anti-Bcl-2 (12789-1-AP), anti-cytochrome c (10993-1-AP), peroxidase-conjugated AffiniPure goat anti-mouse immunoglobulin (Ig)G (H+L) (SA00001-1) and peroxidase-conjugated AffiniPure goat anti-rabbit IgG (H+L) (SA00001-2) Abs were purchased from Proteintech Group, Inc. (Chicago, IL, USA). The anti-calpain-1 catalytic subunit (#31038-1) Ab was purchased from Signalway Antibody LLC (College Park, MD, USA). Cisplatin was purchased from Sigma-Aldrich; Merck KgaA (Darmstadt, Germany) and was dissolved in normal saline for in vitro use. TAT-IDPS was synthesized and purified by ChinaPeptides Co., Ltd. (Shanghai, China) and was dissolved in ddH2O. The sequence for TAT-IDPS is RKKRRQRRRGGNVYTEIKCNSLLPLDDIVRV. 2-Aminoethyl diphenylborinate (2-APB; ab120124) was purchased from Abcam (Hong Kong) Ltd.
Cell lines
Cisplatin-resistant ovarian cancer SKOV3/DDP cells were obtained from the Chinese Academy of Medical Sciences (Beijing, China) and Peking Union Medical College (Beijing, China). Cells were cultured at 37°C in an atmosphere containing 5% CO2 in RPMI-1640 culture medium (Gibco; Thermo Fisher Scientific, Inc., Waltham, MA, USA) supplemented with 10% fetal bovine serum (FBS; Gibco; Thermo Fisher Scientific, Inc.). Cisplatin-resistant SKOV3/DDP cells were maintained in medium containing 1 μg/ml cisplatin (Sigma-Aldrich; Merck KGaA) for 24 h to maintain resistance.
Cell viability assays
Cell viability was determined using the 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) assay. SKOV3/DDP cells were seeded into 96-well culture plates in 100 μl medium at a density of 1×104 cells/well. After 2 days, agents [cisplatin (15 μg/ml) and/ or TAT-IDPS (25 μM) in the presence or absence of 50 μM 2-APB] were added to quadruplicate wells and incubated for 24 or 48 h at 37°C. For the MTT assay (Beyotime Institute of Biotechnology, Shanghai, China), 20 μl/well MTT (5 mg/ml in PBS) was added to each well; after 4 h at 37°C, dimethyl sulfoxide (150 μl/well; Beijing Chemical Industry Group Co., Beijing, China) was added and the plates were agitated at room temperature for 10 min. Absorbance was measured at a wavelength of 570 nm using a microplate reader (BioTek Instruments, Inc., Winooski, VT, USA).
Western blotting
Whole-cell protein extracts were isolated from SKOV3/DDP cells using cell lysis buffer [50 mM Tris-HCl, pH 7.5; 150 mM NaCl; 1 mM sodium-EDTA, 1 mM EDTA; 1% (v/v) Triton X-100; 2.5 mM sodium pyrophos-phate; 1 mM β-glycerophosphate; 1 mM Na3VO4; 1 mM NaF; 1 μg/ml leupeptin and 1 mM phenylmethylsulfonyl fluoride] for western blotting. Protein concentration was quantified using the Quick Start Bradford protein assay kit (Bio-Rad Laboratories, Inc., Hercules, CA, USA). For western blot analysis, lysates (30 μg) were separated by 10% (w/v) SDS-PAGE and were transferred onto immobilon-P transfer membranes (EMD Millipore, Billerica, MA, USA). The membranes were blocked with 5% (w/v) non-fat dry milk in buffer [10 mM Tris-HCl (pH 7.6), 100 mM NaCl, and 0.1% Tween-20] for 1 h at room temperature and were then incubated with the desired primary Abs [caspase-3 (dilution, 1:200); caspase-4 (dilution, 1:200); cleaved caspase-4 (dilution, 1:200); cleaved caspase-3 (dilution, 1:1,000); PDI (dilution, 1:1,000); CHOP (dilution, 1:1,000); β-actin (dilution, 1:2,000); Bax (dilution, 1:1,000); cytochrome c (dilution, 1:1,000); calpain-1 (dilution, 1:200)] overnight at 4°C, followed by incubation with horseradish peroxidase-conjugated secondary Abs (dilution, 1:2,000) for 1.5 h at room temperature. Immunodetection was performed using enhanced chemiluminescence reagents (PE0010-b; Solarbio, New York, NY, USA) and images were captured using Syngene Bio Imaging (Syngene, Cambridge, UK). Protein expression levels were normalized to those of β-actin and the ratios of normalized protein to β-actin are presented as the mean ± standard deviation from three independent experiments. Protein expression levels were semi-quantified by densitometry using Quantity One software (version 4.6.9; Bio-Rad Laboratories, Inc.).
Immunofluorescence staining and confocal laser microscopy
Cells (4×104 cells/well) were cultured on coverslips overnight, following treatment with increasing doses of cisplatin (5, 10 and 15 μg/ml) for 24 h at 37°C, and were fixed with 4% (w/v) paraformaldehyde and stained with nuclear Hoechst 33342 (1 μg/ml; Sigma-Aldrich; Merck KGaA) for 5 min. Subsequently, the cells were washed with PBS and were examined under an Olympus FV1000 confocal laser microscope (Olympus Corporation, Tokyo, Japan) to reveal cell chromatin condensation. The expression of calpain-1 was examined by indirect immunofluorescence. Cells (4×104 cells/ well) were cultured on coverslips overnight, and were then treated with the indicated dose of cisplatin with or without TAT-IDPS for 24 h at 37°C, after which the cells were rinsed with PBS three times. Subsequently, cells were fixed with 4% (w/v) paraformaldehyde for 20 min, permeabilized with 0.1% (v/v) Triton X-100 for 5 min, blocked with bovine serum albumin (PA129262; Thermo Fisher Scientific, Inc.), and incubated with anti-calpain-1 (dilution, 1:100) overnight at 4°C. Cells were then incubated with Alexa Fluor 488 donkey anti-rabbit IgG (#R37602, 1:400 dilution; Invitrogen; Thermo Fisher Scientific, Inc.) for 30 min at room temperature, stained with Hoechst 33342 (1 μg/ml) for 5 min at room temperature, and washed with PBS three times. After mounting, cells were examined under an Olympus FV1000 confocal laser microscope (Olympus Corporation). The same parameters of illumination and detection were maintained digitally throughout the experiments.
Calcium concentration analysis
The Ca2+-sensitive fluorescent dyes Fluo-4/AM (Molecular Probes; Thermo Fisher Scientific, Inc.) and Rhod-2/AM (AAT Bioquest, Sunnyvale, CA, USA) were used to measure Ca2+ concentration according to the manufacturers' protocols. Prior to exposure to various experimental conditions, the cells were incubated with Fluo-4/AM or Rhod-2/AM for 30 min at 37°C. Cell samples were then analyzed by confocal laser microscopy. All experiments were performed in triplicate.
Flow cytometry
Cell death was detected using the Muse® Annexin V Dead Cell kit (EMD Millipore). SKVO3/DDP cells were seeded in 6-well culture plates at a density of 2×105 cells/well. Following treatment under different experimental conditions, cells were trypsinized and resuspended in RPMI-1640 medium supplemented with 10% FBS at a concentration of 1x106 cells/ml. In the dark, cells were incubated with Annexin V at room temperature for 20 min. Finally, cells were measured using the Muse® Cell Analyzer (version 1.5.0.0; EMD Millipore). All experiments were performed in triplicate.
Mitochondrial membrane potential (ΔΨm)
Alterations in ΔΨm during the early stages of apoptosis were assessed using the Muse® MitoPotential assay (MCH 100110; EMD Millipore). SKOV3/DDP cells were treated with cisplatin alone or in combination with TAT-IDPS. Subsequently, cells were centrifuged at 3,000 × g for 5 min at room temperature, and the cell pellet was suspended in assay buffer (1×105 cells/100 μl). MitoPotential dye working solution was added, and the cell suspension was incubated at 37°C for 20 min. Following the addition of Muse® MitoPotential 7-aminoactinomycin D dye (propidium iodide) for 5 min, alterations in ΔΨm and in cellular plasma membrane permeabilization were assessed on the basis of the fluorescence intensities of both dyes, which were analyzed by flow cytometry (Muse® Cell Analyzer version 1.5.0.0; EMD Millipore).
Statistical analysis
Data are representative of three independent experiments performed in triplicate and are presented as the mean ± standard deviation. Data analysis was performed using one-way analysis of variance, and Tukey's post-hoc test was used to determine statistical significance of all pairwise comparisons of interest. P<0.05 was considered to indicate a statistically significant difference. Statistical analyses were performed using the Complex Samples module in IBM SPSS Statistics 20.0 (SPSS, Inc., Chicago, IL, USA)
Results
TAT-IDPS enhances cisplatin-induced cytosolic Ca2+ elevation and mitochondrial Ca2+ overload in SKOV3/DDP cells
TAT-IDPS can enhance IP3R-mediated Ca2+ signals by disrupting the Bcl-2-IP3R interaction. The present study explored whether TAT-IDPS increased cisplatin-induced cytosolic and mitochondrial Ca2+ levels in SKOV3/DDP cells. SKOV3/DDP cells were treated with cisplatin (15 μg/ml) and/or TAT-IDPS (25 μM) for 24 h and Ca2+ levels were then examined in the mitochondria and cytoplasm. The Ca2+-sensitive fluorescent dyes Fluo-4/AM and Rhod-2/AM were used to detect cytosolic and mitochondrial Ca2+ levels by confocal microscopy, respectively. Compared with in the control (untreated) group, cisplatin induced an elevation in free Ca2+ in the cytosol and mitochondria. Furthermore, cisplatin-induced Ca2+ elevation in the cytosol and mitochondria was further increased in the cells treated with cisplatin and TAT-IDPS (Fig. 1).
TAT-IDPS increases cisplatin-induced apoptosis of SKOV3/DDP cells
To evaluate the effects of TAT-IDPS on cisplatin-induced growth inhibition and apoptosis, SKOV3/DDP cells were treated with cisplatin (15 μg/ml) and/or TAT-IDPS (25 μM) for 24 h and growth inhibition was examined using MTT assays. The results indicated that cisplatin induced growth inhibition in SKOV3/DDP cells. In addition, cotreatment with cisplatin and TAT-IDPS increased the growth inhibitory effects of cisplatin, whereas TAT-IDPS alone had no effect on cell viability compared with in the control group (Fig. 2A). Under an optical microscope, it was demonstrated that SKOV3/DDP cells treated with cisplatin became round and fragmented compared with the control cells and that TAT-IDPS enhanced this effect (Fig. 2B). Furthermore, flow cytometric analysis demonstrated that the rate of apoptosis in SKOV3/DDP cells treated with cisplatin and TAT-IDPS was higher than that in cells treated with cisplatin alone (Fig. 2C and D). These results suggested that TAT-IDPS increased cisplatin-induced growth inhibition and apoptosis of SKOV3/DDP cells.
TAT-IDPS increases cisplatin-induced ER stress-associated apoptosis by increasing calpain-1 expression in SKOV3/DDP cells
Since calpain-1, which is a ubiquitous protease, can be activated by cytoplasmic Ca2+ elevation (16), the present study detected the expression of calpain-1 using confocal microscopy. The results indicated that cotreatment with cisplatin and TAT-IDPS for 24 h increased cisplatin-induced calpain-1 accumulation (Fig. 3A). Calpain-1 has been reported to enhance ER-associated apoptosis by cleaving its protein substrates (16). Subsequently, the present study investigated whether TAT-IDPS may sensitize SKOV3/DDP cells to cisplatin-induced ER stress-associated apoptosis. The expression levels of the following ER stress-associated apoptotic proteins: Calpain-1, PDI, CHOP and cleaved caspase-4, were detected by western blot analysis. Cisplatin induced the expression of all four proteins; furthermore, combined treatment with TAT-IDPS enhanced these effects (Fig. 3B and C). These results suggested that TAT-IDPS may increase cisplatin-induced ER stress-associated apoptosis of SKOV3/DDP cells by increasing calpain-1 expression.
TAT-IDPS increases cisplatin-induced mitochondria-mediated apoptosis of SKOV3/DDP cells
Mitochondrial Ca2+ overload can lead to opening of the mitochondrial inner membrane permeability transition pore (MPTP) and can subsequently induce aberrant dissipation of ΔΨm, thus resulting in cell apoptosis. Since an alteration in ΔΨm is considered an early event in apoptosis (17), the present study monitored the effects of TAT-IDPS and/or cisplatin on ΔΨm at 6 h. SKOV3/DDP cells were treated with cisplatin (15 μg/ml) and/or TAT-IDPS (25 μM) for 6 h, and alterations in ΔΨm were determined using flow cytometry. TAT-IDPS enhanced the cisplatin-induced decrease in ΔΨm (Fig. 4A and B). Finally, the expression levels of mitochondrial apoptosis-associated proteins (cytochrome c, Bcl-2, Bax and cleaved caspase-3) were detected using western blotting. The results indicated that cotreatment with cisplatin and TAT-IDPS for 24 h increased the cisplatin-induced Bax/Bcl-2 ratio, and the cisplatin-induced expression of cytochrome c and cleaved caspase-3 (Fig. 4C and D). These results suggested that TAT-IDPS may further reduce the decrease in ΔΨm induced by cisplatin, which may subsequently contribute to mitochondria-mediated apoptosis of SKOV3/DDP cells.
2-APB reduces the growth inhibition and apoptosis induced by cotreatment with TAT-IDPS and cisplatin
To further confirm that mitochondrial Ca2+ overload caused by cotreatment with TAT-IDPS and cisplatin derives from the ER, cells were treated with 2-APB, an IP3R antagonist (18). Cisplatin and TAT-IDPS-induced mitochondrial Ca2+ elevation in SKOV3/DDP cells was markedly reduced in the presence of 2-APB (Fig. 5A). In addition, 2-APB reduced the decrease in ΔΨm induced by cisplatin and TAT-IDPS (Fig. 5B and C). Similarly, cisplatin and TAT-IDPS-induced growth inhibition and apoptosis of SKOV3/DDP cells was markedly reduced in the presence of 2-APB (Fig. 5D–F). Taken together, these results strongly indicated that mitochondrial Ca2+ overload caused by cotreatment with TAT-IDPS and cisplatin was derived from the ER.
Discussion
Bcl-2 is an anti-apoptotic protein that promotes cell survival predominantly by inhibiting the release of cytochrome c from the mitochondria via its BH3 domain. In addition, Bcl-2 inhibits cell apoptosis by reducing Ca2+ release from the ER via its BH4 domain. Recently, targeting the BH3 and BH4 domains to generate Bcl-2 inhibitors for cancer therapy has attracted attention. Obatoclax is a BH3 mimetic that can induce apoptosis of numerous types of cancer cell by interacting with the Bcl-2 BH3 domain; this agent has been tested in a phase II clinical trial in patients (19). Furthermore, Deng et al reported that BDA-366, which is an antagonist of the Bcl-2 BH4 domain, can induce apoptosis of human myeloma U266 cells (20). The results of the present study demonstrated that by targeting BH4, TAT-IDPS increases cisplatin-induced apoptosis of SKOV3/DDP cells (Fig. 2).
As a major intracellular Ca2+ store, the ER serves a central role in intracellular Ca2+ signal transduction, and controls cell death and survival. The release of large amounts of Ca2+ from the ER promotes cell apoptosis by affecting cytoplasmic and mitochondrial Ca2+ homeostasis. There is strong evidence to suggest that Bcl-2 directly inhibits proapoptotic Ca2+ release from IP3R at the ER into the cytoplasm and mitochondria via its BH4 domain (21–23). TAT-IDPS can reverse the Bcl-2-mediated inhibition of IP3-dependent Ca2+ elevation by targeting the BH4 domain, subsequently triggering Ca2+-dependent apoptosis or increasing sensitivity toward proapoptotic stimuli (15). The present study clearly demonstrated that TAT-IDPS increased cisplatin-induced cytoplasmic and mitochondrial Ca2+ elevation (Fig. 1).
Elevation of cytoplasmic Ca2+ levels can lead to activation of a series of Ca2+-sensitive enzymes. Calpain-1 is the target of cytoplasmic Ca2+, which was originally termed μ-calpain based on the Ca2+ concentration (μM range) required for its optimal activity (24). Calpain-1 also participates in the apoptotic pathway triggered by ER stress. Matsuzaki et al confirmed that Ca2+-dependent calpain activation promoted neural cell death by inducing the processing and activation of caspase-4 (25). According to the results of confocal microscopy and western blot analyses, the present study revealed that TAT-IDPS increased cisplatin-induced calpain-1 expression (Fig. 3) and increased cisplatin-induced ER stress-associated apoptosis of SKOV3/DDP cells.
Mitochondria are exposed to high Ca2+ concentrations following the release of Ca2+ from the ER. Accumulation of Ca2+ in the mitochondrial matrix can lead to opening of the MPTP, which in turn causes mitochondrial swelling and rupture, accompanied by dissipation of ΔΨm (26–28). The ΔΨm collapse further induces rupture of the outer membrane and subsequent release of mitochondrial apoptotic factors, including cytochrome c, into the cytosol, finally leading to cell apoptosis (29,30). Our previous study demonstrated that mitochondrial Ca2+ levels are closely associated with cisplatin resistance in ovarian carcinoma cells (11). The present study demonstrated that TAT-IDPS increased cisplatin-induced ΔΨm collapse and mitochondrial-mediated apoptosis of SKOV3/DDP cells. Using 2-APB to effectively block ER Ca2+ release, the present study further confirmed that TAT-IDPS and cisplatin-induced mitochondrial Ca2+ overload is derived from the ER (Fig. 5A).
In conclusion, the results of the present study indicated that TAT-IDPS increased the cisplatin-induced elevation of cytoplasmic and mitochondrial Ca2+, which further increased cisplatin-induced ER stress-mediated apoptosis by increasing calpain-1 expression and activating the mitochondrial apoptotic pathway. These results suggested that Ca2+ release from the ER may regulate cisplatin-induced SKOV3/DDP cell apoptosis, providing a rationale for drugs that specifically disrupt the Bcl-2-IP3R interaction as a novel tool for the treatment of ovarian cancer.
Acknowledgments
The present study was supported by the National Nature and Science Foundation of China (NSFC grant nos. 81372793, 81472419 and 81202552) and the Department of Education of Jilin Province Project (grant no. 2016237). We thank Liwen Bianji for editing the English in this manuscript.
References
Huang J, Liu K, Song D, Ding M, Wang J, Jin Q and Ni J: Krüppel-like factor 4 promotes high-mobility group box 1-induced chemotherapy resistance in osteosarcoma cells. Cancer Sci. 107:242–249. 2016. View Article : Google Scholar : | |
Chen XX, Xie FF, Zhu XJ, Lin F, Pan SS, Gong LH, Qiu JG, Zhang WJ, Jiang QW, Mei XL, et al: Cyclin-dependent kinase inhibitor dinaciclib potently synergizes with cisplatin in preclinical models of ovarian cancer. Oncotarget. 6:14926–14939. 2015. View Article : Google Scholar : PubMed/NCBI | |
Siddiqui WA, Ahad A and Ahsan H: The mystery of BCL2 family: Bcl-2 proteins and apoptosis: an update. Arch Toxicol. 89:289–317. 2015. View Article : Google Scholar : PubMed/NCBI | |
Lutz RJ: Role of the BH3 (Bcl-2 homology 3) domain in the regulation of apoptosis and Bcl-2-related proteins. Biochem Soc Trans. 28:51–56. 2000. View Article : Google Scholar : PubMed/NCBI | |
Fan Z, Yu H, Cui N, Kong X, Liu X, Chang Y, Wu Y, Sun L and Wang G: ABT737 enhances cholangiocarcinoma sensitivity to cisplatin through regulation of mitochondrial dynamics. Exp Cell Res. 335:68–81. 2015. View Article : Google Scholar : PubMed/NCBI | |
Wong M, Tan N, Zha J, Peale FV, Yue P, Fairbrother WJ and Belmont LD: Navitoclax (ABT-263) reduces Bcl-x(L)-mediated chemoresistance in ovarian cancer models. Mol Cancer Ther. 11:1026–1035. 2012. View Article : Google Scholar : PubMed/NCBI | |
Han B, Park D, Li R, Xie M, Owonikoko TK, Zhang G, Sica GL, Ding C, Zhou J, Magis AT, et al: Small-molecule Bcl2 BH4 antagonist for lung cancer therapy. Cancer Cell. 27:852–863. 2015. View Article : Google Scholar : PubMed/NCBI | |
Nakajima A, Tsuji M, Inagaki M, Tamura Y, Kato M, Niiya A, Usui Y and Oguchi K: Neuroprotective effects of propofol on ER stress-mediated apoptosis in neuroblastoma SH-SY5Y cells. Eur J Pharmacol. 725:47–54. 2014. View Article : Google Scholar : PubMed/NCBI | |
Krebs J, Agellon LB and Michalak M: Ca(2+) homeostasis and endoplasmic reticulum (ER) stress: An integrated view of calcium signaling. Biochem Biophys Res Commun. 460:114–121. 2015. View Article : Google Scholar : PubMed/NCBI | |
Liu N, Xu Y, Sun JT, Su J, Xiang XY, Yi HW, Zhang ZC and Sun LK: The BH3 mimetic S1 induces endoplasmic reticulum stress-associated apoptosis in cisplatin-resistant human ovarian cancer cells although it activates autophagy. Oncol Rep. 30:2677–2684. 2013. View Article : Google Scholar : PubMed/NCBI | |
Xu Y, Wang C, Su J, Xie Q, Ma L, Zeng L, Yu Y, Liu S, Li S, et al: Tolerance to endoplasmic reticulum stress mediates cisplatin resistance in human ovarian cancer cells by maintaining endoplasmic reticulum and mitochondrial homeostasis. Oncol Rep. 34:3051–3060. 2015. View Article : Google Scholar : PubMed/NCBI | |
Bonder DE and McCarthy KD: Astrocytic Gq-GPCR-linked IP3R-dependent Ca2+ signaling does not mediate neurovascular coupling in mouse visual cortex in vivo. J Neurosci. 34:13139–13150. 2014. View Article : Google Scholar : PubMed/NCBI | |
Liu Z, Wild C, Ding Y, Ye N, Chen H, Wold EA and Zhou J: BH4 domain of Bcl-2 as a novel target for cancer therapy. Drug Discov Today. 21:989–996. 2016. View Article : Google Scholar : | |
Akl H, Monaco G, La Rovere R, Welkenhuyzen K, Kiviluoto S, Vervliet T, Molgó J, Distelhorst CW, Missiaen L, Mikoshiba K, et al: IP3R2 levels dictate the apoptotic sensitivity of diffuse large B-cell lymphoma cells to an IP3R-derived peptide targeting the BH4 domain of Bcl-2. Cell Death Dis. 4:e6322013. View Article : Google Scholar : PubMed/NCBI | |
Zhong F, Harr MW, Bultynck G, Monaco G, Parys JB, De Smedt H, Rong YP, Molitoris JK, Lam M, Ryder C, et al: Induction of Ca2+-driven apoptosis in chronic lymphocytic leukemia cells by peptide-mediated disruption of Bcl-2-IP3 receptor interaction. Blood. 117:2924–2934. 2011. View Article : Google Scholar : PubMed/NCBI | |
Baudry M and Bi X: Calpain-1 and Calpain-2: The Yin and Yang of Synaptic Plasticity and Neurodegeneration. Trends Neurosci. 39:235–245. 2016. View Article : Google Scholar : PubMed/NCBI | |
Sun X, Xu H, Shen J, Guo S, Shi S, Dan J, Tian F and Tian Y and Tian Y: Real-time detection of intracellular reactive oxygen species and mitochondrial membrane potential in THP-1 macrophages during ultrasonic irradiation for optimal sonodynamic therapy. Ultrason Sonochem. 22:7–14. 2015. View Article : Google Scholar | |
Peppiatt CM, Collins TJ, Mackenzie L, Conway SJ, Holmes AB, Bootman MD, Berridge MJ, Seo JT and Roderick HL: 2-Aminoethoxydiphenyl borate (2-APB) antagonises inositol 1,4,5-trisphosphate-induced calcium release, inhibits calcium pumps and has a use-dependent and slowly reversible action on store-operated calcium entry channels. Cell Calcium. 34:97–108. 2003. View Article : Google Scholar : PubMed/NCBI | |
Schwartz-Roberts JL, Shajahan AN, Cook KL, Warri A, Abu-Asab M and Clarke R: GX15-070 (obatoclax) induces apoptosis and inhibits cathepsin D- and L-mediated autopha-gosomal lysis in antiestrogen-resistant breast cancer cells. Mol Cancer Ther. 12:448–459. 2013. View Article : Google Scholar : PubMed/NCBI | |
Deng J, Park D, Wang M, Nooka A, Deng Q, Matulis S, Kaufman J, Lonial S, Boise LH, Galipeau J, et al: BCL2-BH4 antagonist BDA-366 suppresses human myeloma growth. Oncotarget. 7:27753–27763. 2016. View Article : Google Scholar : PubMed/NCBI | |
Akl H, La Rovere RM, Janssens A, Vandenberghe P, Parys JB and Bultynck G: HA14-1 potentiates apoptosis in B-cell cancer cells sensitive to a peptide disrupting IP3 receptor/Bcl-2 complexes. Int J Dev Biol. 59:391–398. 2015. View Article : Google Scholar | |
Parys JB: The IP3 receptor as a hub for Bcl-2 family proteins in cell death control and beyond. Sci Signal. 7:pe42014. View Article : Google Scholar : PubMed/NCBI | |
Akl H, Vervloessem T, Kiviluoto S, Bittremieux M, Parys JB, De Smedt H and Bultynck G: A dual role for the anti-apoptotic Bcl-2 protein in cancer: Mitochondria versus endoplasmic reticulum. Biochim Biophys Acta. 1843:2240–2252. 2014. View Article : Google Scholar : PubMed/NCBI | |
Pu X, Storr SJ, Ahmad NS, Chan SY, Moseley PM, Televantou D, Cresti N, Boddy A, Ellis IO and Martin SG: Calpain-1 is associated with adverse relapse free survival in breast cancer: A confirmatory study. Histopathology. 68:1021–1029. 2016. View Article : Google Scholar | |
Matsuzaki S, Hiratsuka T, Kuwahara R, Katayama T and Tohyama M: Caspase-4 is partially cleaved by calpain via the impairment of Ca2+ homeostasis under the ER stress. Neurochem Int. 56:352–356. 2010. View Article : Google Scholar | |
Rutter GA and Rizzuto R: Regulation of mitochondrial metabolism by ER Ca2+ release: An intimate connection. Trends Biochem Sci. 25:215–221. 2000. View Article : Google Scholar : PubMed/NCBI | |
von Stockum S, Giorgio V, Trevisan E, Lippe G, Glick GD, Forte MA, Da-Rè C, Checchetto V, Mazzotta G, Costa R, et al: F-ATPase of Drosophila melanogaster forms 53-picosiemen (53-pS) channels responsible for mitochondrial Ca2+-induced Ca2+ release. J Biol Chem. 290:4537–4544. 2015. View Article : Google Scholar : PubMed/NCBI | |
Fülöp L, Rajki A, Maka E, Molnár MJ and Spät A: Mitochondrial Ca2+ uptake correlates with the severity of the symptoms in autosomal dominant optic atrophy. Cell Calcium. 57:49–55. 2015. View Article : Google Scholar | |
Hajnóczky G, Csordás G, Das S, Garcia-Perez C, Saotome M, Sinha Roy S and Yi M: Mitochondrial calcium signalling and cell death: Approaches for assessing the role of mitochondrial Ca2+ uptake in apoptosis. Cell Calcium. 40:553–560. 2006. View Article : Google Scholar | |
Giorgi C, Baldassari F, Bononi A, Bonora M, De Marchi E, Marchi S, Missiroli S, Patergnani S, Rimessi A, Suski JM, et al: Mitochondrial Ca(2+) and apoptosis. Cell Calcium. 52:36–43. 2012. View Article : Google Scholar : PubMed/NCBI |