Spandidos Publications Logo
  • About
    • About Spandidos
    • Aims and Scopes
    • Abstracting and Indexing
    • Editorial Policies
    • Reprints and Permissions
    • Job Opportunities
    • Terms and Conditions
    • Contact
  • Journals
    • All Journals
    • Oncology Letters
      • Oncology Letters
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Oncology
      • International Journal of Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular and Clinical Oncology
      • Molecular and Clinical Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Experimental and Therapeutic Medicine
      • Experimental and Therapeutic Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Molecular Medicine
      • International Journal of Molecular Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Biomedical Reports
      • Biomedical Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Oncology Reports
      • Oncology Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular Medicine Reports
      • Molecular Medicine Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • World Academy of Sciences Journal
      • World Academy of Sciences Journal
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Functional Nutrition
      • International Journal of Functional Nutrition
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Epigenetics
      • International Journal of Epigenetics
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Medicine International
      • Medicine International
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
  • Articles
  • Information
    • Information for Authors
    • Information for Reviewers
    • Information for Librarians
    • Information for Advertisers
    • Conferences
  • Language Editing
Spandidos Publications Logo
  • About
    • About Spandidos
    • Aims and Scopes
    • Abstracting and Indexing
    • Editorial Policies
    • Reprints and Permissions
    • Job Opportunities
    • Terms and Conditions
    • Contact
  • Journals
    • All Journals
    • Biomedical Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Experimental and Therapeutic Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Epigenetics
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Functional Nutrition
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Molecular Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Medicine International
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular and Clinical Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular Medicine Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Oncology Letters
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Oncology Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • World Academy of Sciences Journal
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
  • Articles
  • Information
    • For Authors
    • For Reviewers
    • For Librarians
    • For Advertisers
    • Conferences
  • Language Editing
Login Register Submit
  • This site uses cookies
  • You can change your cookie settings at any time by following the instructions in our Cookie Policy. To find out more, you may read our Privacy Policy.

    I agree
Search articles by DOI, keyword, author or affiliation
Search
Advanced Search
presentation
Oncology Letters
Join Editorial Board Propose a Special Issue
Print ISSN: 1792-1074 Online ISSN: 1792-1082
Journal Cover
July-2017 Volume 14 Issue 1

Full Size Image

Sign up for eToc alerts
Recommend to Library

Journals

International Journal of Molecular Medicine

International Journal of Molecular Medicine

International Journal of Molecular Medicine is an international journal devoted to molecular mechanisms of human disease.

International Journal of Oncology

International Journal of Oncology

International Journal of Oncology is an international journal devoted to oncology research and cancer treatment.

Molecular Medicine Reports

Molecular Medicine Reports

Covers molecular medicine topics such as pharmacology, pathology, genetics, neuroscience, infectious diseases, molecular cardiology, and molecular surgery.

Oncology Reports

Oncology Reports

Oncology Reports is an international journal devoted to fundamental and applied research in Oncology.

Experimental and Therapeutic Medicine

Experimental and Therapeutic Medicine

Experimental and Therapeutic Medicine is an international journal devoted to laboratory and clinical medicine.

Oncology Letters

Oncology Letters

Oncology Letters is an international journal devoted to Experimental and Clinical Oncology.

Biomedical Reports

Biomedical Reports

Explores a wide range of biological and medical fields, including pharmacology, genetics, microbiology, neuroscience, and molecular cardiology.

Molecular and Clinical Oncology

Molecular and Clinical Oncology

International journal addressing all aspects of oncology research, from tumorigenesis and oncogenes to chemotherapy and metastasis.

World Academy of Sciences Journal

World Academy of Sciences Journal

Multidisciplinary open-access journal spanning biochemistry, genetics, neuroscience, environmental health, and synthetic biology.

International Journal of Functional Nutrition

International Journal of Functional Nutrition

Open-access journal combining biochemistry, pharmacology, immunology, and genetics to advance health through functional nutrition.

International Journal of Epigenetics

International Journal of Epigenetics

Publishes open-access research on using epigenetics to advance understanding and treatment of human disease.

Medicine International

Medicine International

An International Open Access Journal Devoted to General Medicine.

Journal Cover
July-2017 Volume 14 Issue 1

Full Size Image

Sign up for eToc alerts
Recommend to Library

  • Article
  • Citations
    • Cite This Article
    • Download Citation
    • Create Citation Alert
    • Remove Citation Alert
    • Cited By
  • Similar Articles
    • Related Articles (in Spandidos Publications)
    • Similar Articles (Google Scholar)
    • Similar Articles (PubMed)
  • Download PDF
  • Download XML
  • View XML
Article Open Access

Identification of differentially expressed inflammatory factors in Wilms' tumors and their association with patient outcomes

  • Authors:
    • Fei Guo
    • Junjie Zhang
    • Lei Wang
    • Wei Zhao
    • Jiekai Yu
    • Shu Zheng
    • Jiaxiang Wang
  • View Affiliations / Copyright

    Affiliations: Department of Pediatric Surgery, The First Affiliated Hospital, Zhengzhou University, Zhengzhou, Henan 450052, P.R. China, Institute of Cancer, The Second Affiliated Hospital, College of Medicine, Zhejiang University, Hangzhou, Zhejiang 310000, P.R. China
    Copyright: © Guo et al. This is an open access article distributed under the terms of Creative Commons Attribution License.
  • Pages: 687-694
    |
    Published online on: May 26, 2017
       https://doi.org/10.3892/ol.2017.6261
  • Expand metrics +
Metrics: Total Views: 0 (Spandidos Publications: | PMC Statistics: )
Metrics: Total PDF Downloads: 0 (Spandidos Publications: | PMC Statistics: )
Cited By (CrossRef): 0 citations Loading Articles...

This article is mentioned in:


Abstract

The present study aimed to identify differentially expressed inflammatory factors observed in Wilms' tumors (WT), and to investigate the association of these factors with clinical stage, pathological type, lymph node metastasis and vascular involvement of WT. Surface‑enhanced laser desorption/ionization‑time of flight mass spectrometry was performed to screen differentially expressed proteins among WT and normal tissue pairs. Upregulated proteins in WT were separated and purified by solid phase extraction and Tricine SDS‑PAGE, respectively. Following in‑gel digestion, the peptide mixture was subjected to liquid chromatography mass spectrometry to identify proteins on the basis of their amino acid sequences. Immunohistochemistry was used to confirm the expression of differentially expressed inflammatory proteins. Of the proteins that were upregulated in WT, two proteins with mass/charge (m/z) ratio of 12,138 and 13,462 were identified as macrophage migration inhibitory factor (MIF) and C‑X‑C motif ligand 7 (CXCL7) chemokine, respectively. The expression of these two proteins was increased in WT compared with adjacent normal tissues and normal renal tissues, and increased with increasing clinical stage. In addition, their expression was significantly increased in patients with unfavorable pathological type, lymph node metastasis and vascular involvement compared with the groups with favorable type, and without lymph node metastasis or vascular involvement (P<0.05). Increased pro‑inflammatory MIF and CXCL7 expression in WT is closely associated with the clinical stage, pathological type, lymph node metastasis and vascular involvement, and may represent biomarkers for the clinical diagnosis of WT.

Introduction

Wilms tumor (WT) is a retroperitoneal solid tumor commonly identified in children and the most common type of renal malignancy in children (1). Early diagnosis of WT is dependent on clinical symptoms and physical and imaging examinations, with pathological examination being the gold standard in WT diagnosis. Although laboratory examination cannot offer specific biomarkers for early diagnosis in WT, certain serum and urine indicators, including α-fetoprotein, and catecholamine metabolites can effectively be used for differential diagnosis between hepatoblastoma and neuroblastoma. Complete resection and chemotherapy are currently the major therapeutic strategies for patients with WT. In addition, kidney transplantation is an effective alternative for the treatment of WT.

The development of mass spectrometry (MS) provides a novel platform for the investigation of diseases. Our group has employed proteomics to screen serum biomarkers in patients with breast cancer, thyroid cancer and WT, which may be useful for the early diagnosis of malignancies (2–4). In previous years, an increasing number of studies have confirmed that inflammatory cytokines are closely associated with oncogenesis, particularly to the growth, invasion, metastasis and immune escape of different types of cancer (5–8). However, the role of inflammatory cytokines in WT remains unclear. In the present study, proteomics was employed to identify differentially expressed inflammatory cytokines in WT and the results were confirmed using immunohistochemistry. Subsequently, associations between the altered expression of these cytokines with clinical stage, pathological type and other characteristics of WT were investigated, which may provide novel therapeutic targets for WT.

Materials and methods

Patients

A total of 40 children (mean age, 2.5±1.5 years; median, 2.5 years; range, 0.3–5.2 years), including 23 males and 17 females, with WT were recruited between January 2010 and December 2014. Adjacent normal tissues (1 cm away from the tumor) were collected from 35 patients, of whom there were 20 males and 15 females with a mean age of 2.2±1.3 years (median, 2.1 years; range, 0.3–4.5 years). Normal kidney tissues (5 cm away from the tumor) were collected from an additional 25 patients, of whom there were 14 males and 11 females with a mean age of 2.2±1.1 years (median, 2.4 years; range, 0.5–4.2 years). No patient received chemotherapy or radiotherapy prior to enrollment into the study, and pathological diagnosis of WT was confirmed by more than two pathologists.

Clinical stage and pathological type were determined according to the criteria described by the National Wilms Tumor Study Group (1). Stage I WT was identified in 6 patients, stage II WT in 12, stage II WT in 13 and stage IV WT in 9. Favorable histology, as indicated by tissue primarily consisting of embryonal, epithelial and stromal cells, was noted in 33 patients, and unfavorable histology in 7 patients. In addition, the absence of lymph node metastasis was noted in 23 patients while 17 exhibited lymph node metastasis. Of the 40 patients, vascular involvement was identified in 9. Fresh tissues (20 mg) were lysed in 200 µl lysis buffer (50 mM Tris, 150 mM NaCl, 1% sodium deoxycholate, 0.1% SDS, 1% NP-40, 1 mM phenylmethane sulfonyl fluoride), followed by centrifugation at 10,000 × g for 20 min at 4°C. The supernatant was harvested and stored at −80°C. The present study was approved by the Ethics Committee of Zhengzhou University, and written informed consent was obtained from the patients parents prior to entry into the study.

Reagents and instruments

Surface-enhanced laser desorption/ionization-time of flight mass spectrometry (SELDI-TOF-MS), weak cation exchange (WCX)-2 SELDI protein chip and Bioprocessor equipment were purchased from Ciphergen Biosystems, Inc., (Fremont, CA, USA). Reagents used for SELDI-TOF-MS were obtained from Sigma-Aldrich; Merck KGaA (Darmstadt, Germany). The Tangential flow ultrafilter (Vivaflow 50) was purchased from Sartorius AG (Göttingen, Germany). The solid phase extraction (SPE) column was purchased from Sigma-Aldrich; Merck KGaA. A vacuum centrifugal concentrator and the protein markers (cat. no. 26628) were purchased from Thermo Fisher Scientific, Inc. (Waltham, MA, USA). The trypsin detection kit was obtained from Promega Corporation (Madison, WI, USA), and the matrix-assisted laser desorption/ionization-TOF-MS was from Bruker AXS GmbH (Karlsruhe, Germany). A rabbit polyclonal antibody [human macrophage migration inhibitory factor (MIF; cat. no. ab65869) and C-X-C motif ligand 7 chemokine (CXCL7; cat. no. ab169946)] and a goat anti-rabbit horseradish peroxidase-conjugated secondary antibody (cat. no. ab205718) were purchased from Abcam (Cambridge, UK).

Screening of inflammatory markers

Following lysis, samples were centrifuged at 4°C for 10 min at 10,000 × g, and the supernatant was collected and added into 96-well plates (5 µl/well), followed by addition of U9 buffer {9M urea, 2% 3-[(3-cholamidopropyl) dimethylammonio]-1-propanesulfonate, 50 mM Tris-HCl, 1% dithiotheritol (DTT), pH 9.0; 10 µl/well}. The plates were incubated at 4°C with a constant agitation for 30 min, and 185 µl NaAc (0.1 M sodium acetate, pH 4.0) was subsequently added and vortexed for 5 min. The WCX-2 SELDI protein chip was fixed in the Bioprocessor, and NaAc was added to each well (200 µl/well) and vortexed at room temperature for 5 min in the rotating platform, repeat once. The samples were added to the protein chip (100 µl/well) and vortexed at 4°C for 60 min. The chip was dried, and NaAc was added (200 µl/well) and vortexed for 5 min. This was repeated three times. Following two washes with 200 µl deionized water to each well, 1 µl of saturated SPA solution [SPA, 50% acetonitrile (ACN), 0.5% trifluoroacetic acid (TFA)] was added to each well, and the chip was air-dried. Finally, the chip was placed in the SELDI-TOF-MS machine for the detection of the protein peaks.

Identification of inflammatory cytokines

For sample processing, 1 ml protein sample was mixed with 5 ml of deionized water. The peristaltic pumps and tangential flow ultrafilter were connected, and the inlet and outlet tubes were subsequently placed in the protein sample to form a loop. The collection tube was placed in a centrifuge tube, and the filtrate was collected without proteins >30 kDa. The filtrate was stored at −80°C and freeze-dried. The dry powder was dissolved in deionized water to a final volume of 250 µl.

The proteins were next separated with a SPE column. In brief, 250 µl samples were mixed with 500 µl U9 buffer, followed by incubation at 4°C for 30 min with constant agitation, then 250 µl sample buffer was added (2% TFA and 20% ACN). Subsequently, 1 tube volume of activation solution (100% ACN) was added into the tube. This step was repeated once, then 1 tube volume of equilibration solution (0.5% TFA, 5% ACN) was added (this step was repeated twice). Following this, 1 ml sample was added into the tube and collected, and this step was repeated once more. Subsequently, 2 ml equilibration solution was used to wash the tube, and this step was repeated once. The elution buffer (250 µl) at different concentrations (30, 50, 70 and 100% ACN containing 0.1% TFA) was added, which was repeated once, and the filtrate was collected into a vacuum centrifugal concentrator. Centrifugation was conducted at room temperature for 4–6 h at 10,000 × g. Following centrifugation, 10 µl mixture was collected.

The target proteins were separated using 12% Tricine SDS-PAGE (200 µg/lane) and stained with 0.25% Coomassie Brilliant Blue. The target bands were collected into EP tubes, and 80 µl washing buffer (50% ACN and 25 mM NH4HCO3) was subsequently added at 37°C for 20 min with constant agitation. Following three washes and drying at 90°C for 15 min, 20 µl digestion buffer (100 mM NH4HCO3) and 2 µl dilute reductant (100 mM DTT and 100 mM NH4HCO3) were added, followed by incubation at 37°C for 10 min. Subsequent to the mixture being allowed to cool to room temperature, 2 µl blocker solution (550 mM C2H4INO and 100 mM NH4HCO3) was added at room temperature for 10 min, followed by 0.5 µl dilute trypsin solution to a final concentration of trypsin at 8 ng/µl. Following centrifugation at 3,000 × g for 5 min, the in-gel digestion continued at 37°C for 12 h. Centrifugation was performed at 1,000 × g for 15 min, and the supernatant was harvested.

Following digestion, the peptide mixture was subjected to separation with nano-liquid chromatography (LC), and the resultant mixture was added into a MALDI-TOF-MS. Subsequent to MS/MS, the sequences of corresponding peptides were recognized and searched via Mascot. The corresponding proteins were searched in the Swiss-Prot database (http://www.uniprot.org/).

Validation of inflammatory cytokines

Fresh tissues were embedded in paraffin, 5-µm sectioned, and deparaffinized with graded ethanol (100, 95, 85 and 75%). Antigen retrieval was performed in citrate buffer (0.01 M Na3C6H5O7-2H2O, pH 6.0) for 10 min. Subsequently, sections were treated with 3% H2O2 for 30 min at room temperature to block the endogenous peroxidase and subsequently blocked with goat serum at room temperature for 30 min. Following incubation with the anti-MIF and anti-CXCL7 primary antibodies (1:500 dilution) at 4°C for 12 h, the sections were treated with secondary antibodies (1:1,000 dilution) at 37°C for 30 min, followed by three washes in PBS. Visualization was conducted with 3,3-diaminobenzidine for 3 min, which was stopped by washing with flowing water. Counterstaining was performed using hematoxylin. Following dehydration with ethanol and transparentization with xylene, the sections were mounted in neutral gum.

Expression levels of MIF and CXCL7 depended on the mean density of staining. The positive rates of MIF and CXCL7 was determined on the basis of the staining intensity and number of positive cells. Staining intensity: No staining, 0; yellow, 1; yellow-brown, 2; and brown, 3. The number of positive cells: <25%, 1; ≥25%, <50%, 2; ≥50%, <75%, 3; and ≥75%, 4. The product of the two scores was the final score: -, 0–3; +, 3–6; ++, 6–9; and +++, >9.

Statistical analysis

Quantitative data were compared using two-tailed Students t-tests with an α of 0.05 between two groups. Kruskal-Wallis tests were employed for comparisons of the quantitative data among groups, followed by paired comparisons with Tamhanes T2 tests (α=0.05). Comparisons of qualitative data among the groups were performed with χ2 tests with an α of 0.05, and paired comparisons were performed with an α of 0.01 between two groups.

Results

Screening and identification of inflammatory cytokines

Mass spectrometry data from WT tissues, adjacent normal tissues and normal renal tissues were subjected to standardization with the ZUCI-ProteinChip Data Analysis System, and corresponding protein peaks were obtained using cluster analysis. In WT tissues, five differentially strongly expressed protein peaks were identified, including m/z12138 and m/z13462 that were identified as being the MIF and the CXCL7 chemokine. The expression of the two inflammation peaks was significantly increased in WT tissues (1,437.8±997.3 and 1,730.4±1,147.8, respectively), compared with adjacent normal tissues (952.6±591.2 and 1,031.1±1,120.8, respectively) and normal renal tissues (315.4±296.5 and 114.7±118.9, respectively; all P<0.05; Fig. 1).

Figure 1.

The expression of two proteins in three different tissue types obtained from patients with Wilms tumor. Arrows denote the proteins at m/z12138 and m/z13462, identified as macrophage migration inhibitory factor and C-X-C motif ligand 7 chemokine, respectively. The left panel indicates simulated protein peaks, and the right panel of simulated electrophoresis reveals strong to weak expression (red to blue, respectively). TT, tumor tissue; AT, adjacent tissue; NT, normal tissue.

Although the expression of the two inflammation peaks was not associated with age or gender (P>0.05), their expression significantly increased with the progression of WT (P<0.001): 678.8±189.0 and 746.2±238.7, respectively in stage I WT; 664.0±202.0 and 1,180.7±404.9, respectively in stage II WT; 1,524.7±407.9 and 2,160.4±1,252.3, respectively in stage III WT; and 2,850.2±861.2 and 2,498.4±1,290.5, respectively in stage IV WT (Fig. 2). In addition, the expression level of m/z12138 and m/z13462 was significantly lower in WT patients with favorable histology compared with those with unfavorable histology (1,152.3±735.5 and 1,281.0±630.6, respectively vs. 2,783.9±872.4 and 3,848.8±310.2, respectively; P<0.001; Fig. 2). Additionally, the expression levels of the two peaks were significantly lower in patients without lymph node metastasis compared with patients with lymph node metastasis (869.2±474.6 and 1,110.2±433.6, respectively vs. 2,207.1±961.7 and 2,569.5±1,285.2, respectively; P<0.01; Fig. 3). m/z12138 and m/z13462 expression was also significantly lower in patients without vascular involvement compared with those with vascular involvement (1,027.8±521.3 and 1,507.5±1,019.9, respectively vs. 2,850.2±861.2 and 2,498.4±1,290.5, respectively; P≤0.021; Fig. 3). The characteristics of the patients are summarized in Table I.

Figure 2.

The expression of the two proteins gradually increased with increasing clinical stage of patients with Wilms tumor. The expression of both proteins was stronger in the UH group compared with that in the FH group. Arrows denote the proteins at m/z12138 and m/z13462, identified as macrophage migration inhibitory factor and C-X-C motif ligand 7 chemokine, respectively. I, II, III and IV refer to clinical stage. FH, favorable histology; UH, unfavorable histology.

Figure 3.

The expression of two proteins were significantly lower in patients with Wilms tumor without lymph node metastasis compared with patients with lymph node metastasis, and also significantly lower in patients without vascular involvement compared with those with vascular involvement. Arrows denote the proteins at m/z12138 and m/z13462, identified as macrophage migration inhibitory factor and C-X-C motif ligand 7 chemokine, respectively. N0, no lymph node metastasis; N1, lymph node metastasis; V0, no vascular involvement; V1, vascular involvement.

Table I.

Association between the expression of m/z12138 and m/z13462 peaks and clinical characteristics.

Table I.

Association between the expression of m/z12138 and m/z13462 peaks and clinical characteristics.

m/z12138m/z13462


VariablesnIntensity (x±s)P-valueIntensity (x±s)P-value
Tissue type <0.001 <0.001
  TT401,437.8±997.30.031a1,730.4±1,147.80.019a
  AT35952.6±591.2 <0.001b 1,031.1±1,120.8 <0.001b
  NT25315.4±296.5 <0.001c114.7±118.9 <0.001c
Genderd 0.496 0.677
  Male231,339.3±773.0 1,796.7±1,063.9
  Female17 1,571.1±1,214.0 1,640.7±1,280.6
Age, years 0.610 0.655
  <2.5201,518.0±821.2 1,813.0±1,310.1
  ≥2.520 1,357.6±1,128.1 1,647.8±986.6
Clinical stage <0.001 <0.001
  I6678.8±189.0 746.2±238.7
  II12664.0±202.0 1,180.7±404.9
  III131,524.7±407.9 2,160.4±1,252.3
  IV92,850.2±861.2 2,498.4±1,290.5
Pathological type <0.001 <0.001
  FH331,152.3±735.5 1,281.0±630.6
  UH72,783.9±872.4 3,848.8±310.2
Lymph node metastasis <0.001 <0.001
  N23869.2±474.6 1,110.2±433.6
  Y172,207.1±961.7 2,569.5±1,285.2
Vascular invasion <0.001 0.021
  N311,027.8±521.3 1,507.5±1,019.9
  Y92,850.2±861.2 2,498.4±1,290.5

a TT vs. AT

b TT vs. NT

c AT vs. NT

d variables associated with TT. Students t-test in comparison between two groups. Kruskal-Wallis test in comparison among multiple groups. Tamhanes T2 test in pairwise comparison among multiple groups. Test standard α=0.05. TT, tumor tissue; AT, adjacent tissue (1 cm from tumor edge); NT, normal tissue (5 cm from tumor edge); FH, favorable histology; UH, unfavorable histology; N, no; Y, yes.

Upregulated proteins of m/z12138 and m/z13462 in WT were separated and purified by SPE and Tricine-SDS-PAGE, respectively. Following in-gel digestion, the peptide mixture was subjected to LC-MS/MS. Finally, proteins of m/z12138 and m/z13462 were identified as MIF and CXCL7 on the basis of their amino acid sequences through matrix-assisted laser desorption/ionization-TOF-MS (Fig. 4; Table II).

Figure 4.

Analysis of peptides obtained subsequent to in-gel digestion. Peptides following digestion were subjected to liquid chromatography- mass spectrometry, and sequences were obtained. (A) m/z12138 and (B) m/z13462.

Table II.

Identification of the two inflammation protein biomarkers with identified peptides and covered sequence.

Table II.

Identification of the two inflammation protein biomarkers with identified peptides and covered sequence.

m/zProtein nameIdentified peptidesSequence
12138MIFPMFIVNTNVPR MFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIA
RASVPDGFLSELTQQLAQATGK VHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYS
RSYSKLLCGLLAER KLLCGLLAER
LLCGLLAER
13462CXCL7 GKEESLDSDLYAELR GKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGK
NIQSLEVIGK GTHCNQVEVIATLKDGRKICLDPDAPR
GTHCNQVEVIATLK
KICLDPDAPR

[i] Bold letters denote the identified peptides that cover the sequence. MIF, macrophage migration inhibitory factor; CXCL7, C-X-C motif ligand 7 chemokine.

Detection of MIF and CXCL7 by immunohistochemistry

MIF expression was 0.0530±0.0145 in WT tissues, 0.0106±0.0042 in adjacent normal tissues and 0.0008±0.0006 in normal renal tissues (P<0.001). In addition, CXCL7 expression was 0.0495±0.0240 in WT tissues, 0.0138±0.0063 in adjacent normal tissues and 0.0009±0.0005 in normal renal tissues, (P<0.001) (Fig. 5; Table III), confirming that the expression levels of the two cytokines were significantly increased in WT.

Figure 5.

Immunohistochemistry analysis of MIF and CXCL7 expression in WT. All images were taken at magnification, ×400 (scale, 50 µm). (A) MIF expression in WT tissue, (B) adjacent normal tissue and (C) normal renal tissue samples. (D) CXCL7 expression in WT tissue, (E) adjacent normal tissue and (F) normal renal tissue samples. MIF, macrophage migration inhibitory factor; CXCL7, C-X-C motif ligand 7 chemokine; WT, Wilms tumor.

Table III.

Expression of MIF and CXCL7 in TT, AT and NT through immunohistochemistry.

Table III.

Expression of MIF and CXCL7 in TT, AT and NT through immunohistochemistry.

MIFCXCL7


Tissue typenMean densityP-valueMean densityP-value
TT400.0530±0.0145 <0.001a0.0495±0.0240 <0.001a
AT350.0106±0.0042 <0.001b0.0138±0.0063 <0.001b
NT250.0008±0.0006 <0.001c0.0009±0.0005 <0.001c

a TT vs. AT

b TT vs. NT

c AT vs. NT. MIF, macrophage migration inhibitory factor; CXCL7, C-X-C motif ligand 7 chemokine; TT, tumor tissue; AT, adjacent tissue (1 cm from tumor edge); NT, normal tissue (5 cm from tumor edge).

The number of cells positive for MIF was 92.5% (37/40) in WT tissues, 57.1% (20/35) in adjacent normal tissues and 16.0% (4/25) in normal renal tissues (P<0.01). In addition, the number of cells positive for CXCL7 was 87.5% (35/40) in WT tissues, 48.6% (17/35) in adjacent normal tissues, and 12.0% (3/25) in normal tissues (P<0.01; Table IV).

Table IV.

Positive rate of MIF and CXCL7 in TT, AT and NT through immunohistochemistry.

Table IV.

Positive rate of MIF and CXCL7 in TT, AT and NT through immunohistochemistry.

MIFCXCL7


Tissue typenPositive (%)Negative (%)P-valuePositive (%)Negative (%)P-value
TT4037 (92.5)3 (7.5) <0.001a35 (87.5)5 (12.5) <0.001a
AT3520 (57.1)15 (42.9) <0.001b17 (48.6)18 (51.4) <0.001b
NT254 (16.0)21 (84.0)0.001c3 (12.0)21 (88.0)0.007c

{ label (or @symbol) needed for fn[@id='tfn9-ol-0-0-6261'] } χ2 test used in comparison among multiple groups, test standard α=0.05; pairwise comparison among three groups, test standard α=0.01, following Bonferroni method rectification.

a TT vs. AT

b TT vs. NT

c AT vs. NT. MIF, macrophage migration inhibitory factor; CXCL7, C-X-C motif ligand 7 chemokine; TT, tumor tissue; AT, adjacent tissue (1 cm from tumor edge); NT, normal tissue (5 cm from tumor edge).

Discussion

Proteomics has been employed to investigate the structure, function and characteristics of the proteome in tissues, organs and cells, and has become an important technique in life sciences in the post-genomics era. In our previous studies (2–4), several serum protein markers were identified to be associated with the occurrence and development of breast and thyroid cancer and WT. As the molecular weights of inflammatory cytokines ranges between 10 and 30 kDa, the molecular weight was adjusted to a range of 3–30 kDa in the SELDI-TOF-MS. In addition, prior to the separation and purification of the target proteins, proteins >30 kDa were removed to avoid interference in subsequent gel electrophoresis and purification using a tangential flow ultrafilter, which is a reliable biological membrane that may be used to remove proteins >30 kDa. The separation and purification of target proteins is dependent on SPE and gel electrophoresis, so that the subsequent identification may have improved accuracy.

Of the differentially expressed proteins that were upregulated in WT, proteins at m/z12138 and m/z13462 were identified as MIF and CXCL7; their upregulation in WT was confirmed by immunohistochemistry. The expression of these two cytokines was reduced in the adjacent normal tissues and again in the normal tissues compared with the WT tissues, suggesting that the two cytokines are closely associated with the occurrence and development of WT. In addition, their expression increased with the WT progression and increased malignancy. Thus, these cytokines may represent markers indicative of clinical stage and pathological type. Additionally, their expression in tumor samples from patients with WT with lymph node metastasis/vascular involvement was significantly increased compared with adjacent tissue samples, suggesting that each may perform important roles in the invasion and metastasis of WT.

MIF is a multifunctional protein that is primarily synthesized by activated lymphocytes and macrophages (9). It may also be synthesized in the parenchymal cells of the liver, spleen and kidney (10). MIF is an important regulator of inflammation and the immune response, and may also be a key negative regulator that blocks the anti-inflammatory effect of glucocorticoids (10). A previous study has confirmed that MIF may act as a specific biomarker in inflammation-mediated diseases (11). In addition, MIF performs important roles in the proliferation, metastasis, immune escape and angiogenesis of cancer cells, including studies in prostate (12), bladder (13) and lung cancer (14–16), melanoma (17), colon (18), oral (19), breast (20,21) and head and neck squamous cell cancer (22). In glioma (23), ovarian cancer (24) and neuroblastoma (25), MIF may inhibit the cytotoxicity of NK cells and T-lymphocytes, facilitating the immune escape of cancer cells and compromising the clearance of cancer cells by the immune system. Thus, MIF may represent a biomarker for the diagnosis of malignancies, and a novel therapeutic target that may improve the killing of cancer cells by the immune system.

CXCL7, a member of the CXC chemokine subfamily, is involved in inflammation. CXCL7 as a chemical irritant may induce the directional migration of leukocytes, and is primarily secreted by macrophages, lymphocytes, endothelial cells and fibroblasts. CXCL7, as an important cytokine, is not only involved in a variety of physiological and pathological processes including hemopoiesis and inflammation reaction (26–30), but is also closely associated with the occurrence and development of numerous types of cancer (31–35). However, to the best of our knowledge, the roles of MIF and CXCL7 in WT have not previously been examined.

Pathological examination is the most commonly used method for the diagnosis of WT. However, there is no widely accepted pathological marker indicative of cancer progression. The results of the present study demonstrated that MIF and CXCL7 may become important biomarkers indicative of clinical stage and pathological type of WT. Chemotherapy and immune therapy are the main strategies used for patients with WT. The wide application of an MIF blocker (36) provides a novel prospect for the therapy of WT. However, the specific biological roles of MIF and CXCL7 in WT remain poorly understood, and additional studies are required to confirm them.

References

1 

Metzger ML and Dome JS: Current therapy for Wilms tumor. Oncologist. 10:815–826. 2005. View Article : Google Scholar : PubMed/NCBI

2 

Fan Y, Shi L, Liu Q, Dong R, Zhang Q, Yang S, Fan Y, Yang H, Wu P, Yu J, et al: Discovery and identification of potential biomarkers of papillary thyroid carcinoma. Molecular Cancer. 8:792009. View Article : Google Scholar : PubMed/NCBI

3 

Zhang Q, Wang J, Dong R, Yang S and Zheng S: Identification of novel serum biomarkers in child nephroblastoma using proteomics technology. Mol Biol Rep. 38:631–638. 2011. View Article : Google Scholar : PubMed/NCBI

4 

Fan Y and Wang J, Yang Y, Liu Q, Fan Y, Yu J, Zheng S, Li M and Wang J: Detection and identification of potential biomarkers of breast cancer. J Cancer Res Clin. 136:1243–1254. 2010. View Article : Google Scholar

5 

Mitchell JK, Lemon SM and McGivern DR: How do persistent infections with hepatitis C virus cause liver cancer? Curr Opin Virol. 14:101–108. 2015. View Article : Google Scholar : PubMed/NCBI

6 

Umansky V and Sevko A: Overcoming immunosuppression in the melanoma microenvironment induced by chronic inflammation. Cancer Immunol Immunother. 61:275–282. 2012. View Article : Google Scholar : PubMed/NCBI

7 

Kanterman J, Sade-Feldman M and Baniyash M: New insights into chronic inflammation-induced immunosuppression. Semin Cancer Biol. 22:307–318. 2012. View Article : Google Scholar : PubMed/NCBI

8 

Ringelhan M, OConnor T, Protzer U and Heikenwalder M: The direct and indirect roles of HBV in liver cancer: Prospective markers for HCC screening and potential therapeutic targets. J Pathol. 235:355–367. 2015. View Article : Google Scholar : PubMed/NCBI

9 

Lue H, Kleemann R, Calandra T, Roger T and Bernhagen J: Macrophage migration inhibitory factor (MIF): Mechanisms of action and role in disease. Microbes Infect. 4:449–460. 2002. View Article : Google Scholar : PubMed/NCBI

10 

Calandra T and Roger T: Macrophage migration inhibitory factor: A regulator of innate immunity. Nat Rev Immunol. 3:791–800. 2003. View Article : Google Scholar : PubMed/NCBI

11 

Grieb G, Merk M, Bernhagen J and Bucala R: Macrophage migration inhibitory factor (MIF): A promising biomarker. Drug News Perspect. 23:257–264. 2010. View Article : Google Scholar : PubMed/NCBI

12 

Meyer-Siegler KL, Iczkowski KA, Leng L, Bucala R and Vera PL: Inhibition of macrophage migration inhibitory factor or its receptor (CD74) attenuates growth and invasion of DU-145 prostate cancer cells. J Immunol. 177:8730–8739. 2006. View Article : Google Scholar : PubMed/NCBI

13 

Choudhary S, Hegde P, Pruitt JR, Sielecki TM, Choudhary D, Scarpato K, Degraff DJ, Pilbeam CC and Taylor JA III: Macrophage migratory inhibitory factor promotes bladder cancer progression via increasing proliferation and angiogenesis. Carcinogenesis. 34:2891–2899. 2013. View Article : Google Scholar : PubMed/NCBI

14 

Arenberg D, Luckhardt TR, Carskadon S, Zhao L, Amin MA and Koch AE: Macrophage migration inhibitory factor promotes tumor growth in the context of lung injury and repair. Am J Resp Crit Care. 182:1030–1037. 2010. View Article : Google Scholar

15 

Gámez-Pozo A, Sánchez-Navarro I, Calvo E, Agulló-Ortuño MT, López-Vacas R, Díaz E, Camafeita E, Nistal M, Madero R, Espinosa E, et al: PTRF/Cavin-1 and MIF proteins are identified as non-small cell lung cancer biomarkers by label-free proteomics. PLoS One. 7:e337522012. View Article : Google Scholar : PubMed/NCBI

16 

McClelland M, Zhao L, Carskadon S and Arenberg D: Expression of CD74, the receptor for macrophage migration inhibitory factor, in non-small cell lung cancer. Am J Pathol. 174:638–646. 2009. View Article : Google Scholar : PubMed/NCBI

17 

Tanese K, Hashimoto Y, Berkova Z, Wang Y, Samaniego F, Lee JE, Ekmekcioglu S and Grimm EA: Cell Surface CD74-MIF interactions drive melanoma survival in response to interferon-γ. J Invest Dermatol. 135:2775–2784. 2015. View Article : Google Scholar : PubMed/NCBI

18 

Gordon-Weeks AN, Lim SY, Yuzhalin AE, Jones K and Muschel R: Macrophage migration inhibitory factor: A key cytokine and therapeutic target in colon cancer. Cytokine Growth Factor Rev. 26:451–461. 2015. View Article : Google Scholar : PubMed/NCBI

19 

Chang KP, Lin SJ, Liu SC, Yi JS, Chien KY, Chi LM, Kao HK, Liang Y, Lin YT, Chang YS and Yu JS: Low-molecular-mass secretome profiling identifies HMGA2 and MIF as prognostic biomarkers for oral cavity squamous cell carcinoma. Sci Rep. 5:116892015. View Article : Google Scholar : PubMed/NCBI

20 

Verjans E, Noetzel E, Bektas N, Schütz AK, Lue H, Lennartz B, Hartmann A, Dahl E and Bernhagen J: Dual role of macrophage migration inhibitory factor (MIF) in human breast cancer. BMC Cancer. 9:2302009. View Article : Google Scholar : PubMed/NCBI

21 

Richard V, Kindt NG, Decaestecker C, Gabius HJ, Laurent G, Noël JC and Saussez S: Involvement of macrophage migration inhibitory factor and its receptor (CD74) in human breast cancer. Oncol Rep. 32:523–529. 2014.PubMed/NCBI

22 

Kindt N, Lechien JR, Nonclercq D, Laurent G and Saussez S: Involvement of CD74 in head and neck squamous cell carcinomas. J Cancer Res Clin. 140:937–947. 2014. View Article : Google Scholar

23 

Mittelbronn M, Platten M, Zeiner P, Dombrowski Y, Frank B, Zachskorn C, Harter PN, Weller M and Wischhusen J: Macrophage migration inhibitory factor (MIF) expression in human malignant gliomas contributes to immune escape and tumour progression. Acta Neuropathol. 122:353–365. 2011. View Article : Google Scholar : PubMed/NCBI

24 

Krockenberger M, Dombrowski Y, Weidler C, Ossadnik M, Hönig A, Häusler S, Voigt H, Becker JC, Leng L, Steinle A, et al: Macrophage migration inhibitory factor (MIF) contributes to the immune escape of ovarian cancer by downregulating NKG2D1. J Immunol. 180:7338–7348. 2008. View Article : Google Scholar : PubMed/NCBI

25 

Zhou Q, Yan X, Gershan J, Orentas RJ and Johnson BD: Expression of macrophage migration inhibitory factor by neuroblastoma leads to the inhibition of antitumor T cell reactivity in vivo. J Immunol. 181:1877–1886. 2008. View Article : Google Scholar : PubMed/NCBI

26 

Pillai MM, Iwata M, Awaya N, Graf L and Torok-Storb B: Monocyte-derived CXCL7 peptides in the marrow microenvironment. Blood. 107:3520–3526. 2006. View Article : Google Scholar : PubMed/NCBI

27 

Pecks U, Kirschner I, Wölter M, Schlembach D, Koy C, Rath W and Glocker MO: Mass spectrometric profiling of cord blood serum proteomes to distinguish infants with intrauterine growth restriction from those who are small for gestational age and from control individuals. Transl Res. 164:57–69. 2014. View Article : Google Scholar : PubMed/NCBI

28 

Ehlken C, Grundel B, Michels D, Junker B, Stahl A, Schlunck G, Hansen LL, Feltgen N, Martin G, Agostini HT and Pielen A: Increased expression of angiogenic and inflammatory proteins in the vitreous of patients with ischemic central retinal vein occlusion. PLoS One. 10:e01268592015. View Article : Google Scholar : PubMed/NCBI

29 

Yeo L, Adlard N, Biehl M, Juarez M, Smallie T, Snow M, Buckley CD, Raza K, Filer A and Scheel-Toellner D: Expression of chemokines CXCL4 and CXCL7 by synovial macrophages defines an early stage of rheumatoid arthritis. Ann Rheum Dis. 75:763–771. 2016. View Article : Google Scholar : PubMed/NCBI

30 

Ghasemzadeh M, Kaplan ZS, Alwis I, Schoenwaelder SM, Ashworth KJ, Westein E, Hosseini E, Salem HH, Slattery R, McColl SR, et al: The CXCR1/2 ligand NAP-2 promotes directed intravascular leukocyte migration through platelet thrombi. Blood. 121:4555–4566. 2013. View Article : Google Scholar : PubMed/NCBI

31 

Giuliano S, Guyot M, Grépin R and Pagès G: The ELR+CXCL chemokines and their receptors CXCR1/CXCR2: A signaling axis and new target for the treatment of renal cell carcinoma. OncoImmunology. 3:e283992014. View Article : Google Scholar : PubMed/NCBI

32 

Matsubara J, Honda K, Ono M, Tanaka Y, Kobayashi M, Jung G, Yanagisawa K, Sakuma T, Nakamori S, Sata N, et al: Reduced plasma level of CXC chemokine ligand 7 in patients with pancreatic cancer. Cancer Epidemiol Biomarkers Prev. 20:160–171. 2011. View Article : Google Scholar : PubMed/NCBI

33 

Tang Z, Yu M, Miller F, Berk RS, Tromp G and Kosir MA: Increased invasion through basement membrane by CXCL7-transfected breast cells. Am J Surg. 196:690–696. 2008. View Article : Google Scholar : PubMed/NCBI

34 

Grépin R, Guyot M, Giuliano S, Boncompagni M, Ambrosetti D, Chamorey E, Scoazec JY, Negrier S, Simonnet H and Pagès G: The CXCL7/CXCR1/2 axis is a key driver in the growth of clear cell renal cell carcinoma. Cancer Res. 74:873–883. 2014. View Article : Google Scholar : PubMed/NCBI

35 

Desurmont T, Skrypek N, Duhamel A, Jonckheere N, Millet G, Leteurtre E, Gosset P, Duchene B, Ramdane N, Hebbar M, et al: Overexpression of chemokine receptor CXCR2 and ligand CXCL7 in liver metastases from colon cancer is correlated to shorter disease-free and overall survival. Cancer Sci. 106:262–269. 2015. View Article : Google Scholar : PubMed/NCBI

36 

Xu L, Li Y, Sun H, Zhen X, Qiao C, Tian S and Hou T: Current developments of macrophage migration inhibitory factor (MIF) inhibitors. Drug Discov Today. 18:592–600. 2013. View Article : Google Scholar : PubMed/NCBI

Related Articles

  • Abstract
  • View
  • Download
  • Twitter
Copy and paste a formatted citation
Spandidos Publications style
Guo F, Zhang J, Wang L, Zhao W, Yu J, Zheng S and Wang J: Identification of differentially expressed inflammatory factors in Wilms' tumors and their association with patient outcomes. Oncol Lett 14: 687-694, 2017.
APA
Guo, F., Zhang, J., Wang, L., Zhao, W., Yu, J., Zheng, S., & Wang, J. (2017). Identification of differentially expressed inflammatory factors in Wilms' tumors and their association with patient outcomes. Oncology Letters, 14, 687-694. https://doi.org/10.3892/ol.2017.6261
MLA
Guo, F., Zhang, J., Wang, L., Zhao, W., Yu, J., Zheng, S., Wang, J."Identification of differentially expressed inflammatory factors in Wilms' tumors and their association with patient outcomes". Oncology Letters 14.1 (2017): 687-694.
Chicago
Guo, F., Zhang, J., Wang, L., Zhao, W., Yu, J., Zheng, S., Wang, J."Identification of differentially expressed inflammatory factors in Wilms' tumors and their association with patient outcomes". Oncology Letters 14, no. 1 (2017): 687-694. https://doi.org/10.3892/ol.2017.6261
Copy and paste a formatted citation
x
Spandidos Publications style
Guo F, Zhang J, Wang L, Zhao W, Yu J, Zheng S and Wang J: Identification of differentially expressed inflammatory factors in Wilms' tumors and their association with patient outcomes. Oncol Lett 14: 687-694, 2017.
APA
Guo, F., Zhang, J., Wang, L., Zhao, W., Yu, J., Zheng, S., & Wang, J. (2017). Identification of differentially expressed inflammatory factors in Wilms' tumors and their association with patient outcomes. Oncology Letters, 14, 687-694. https://doi.org/10.3892/ol.2017.6261
MLA
Guo, F., Zhang, J., Wang, L., Zhao, W., Yu, J., Zheng, S., Wang, J."Identification of differentially expressed inflammatory factors in Wilms' tumors and their association with patient outcomes". Oncology Letters 14.1 (2017): 687-694.
Chicago
Guo, F., Zhang, J., Wang, L., Zhao, W., Yu, J., Zheng, S., Wang, J."Identification of differentially expressed inflammatory factors in Wilms' tumors and their association with patient outcomes". Oncology Letters 14, no. 1 (2017): 687-694. https://doi.org/10.3892/ol.2017.6261
Follow us
  • Twitter
  • LinkedIn
  • Facebook
About
  • Spandidos Publications
  • Careers
  • Cookie Policy
  • Privacy Policy
How can we help?
  • Help
  • Live Chat
  • Contact
  • Email to our Support Team