Open Access

Alternative splicing of BCL‑X and implications for treating hematological malignancies (Review)

  • Authors:
    • Wanling Chen
    • Jinggang Li
  • View Affiliations

  • Published online on: July 18, 2021     https://doi.org/10.3892/ol.2021.12931
  • Article Number: 670
  • Copyright: © Chen et al. This is an open access article distributed under the terms of Creative Commons Attribution License.

Metrics: Total Views: 0 (Spandidos Publications: | PMC Statistics: )
Total PDF Downloads: 0 (Spandidos Publications: | PMC Statistics: )


Abstract

BCL‑X is a member of the BCL‑2 family. It regulates apoptosis and plays a critical role in hematological malignancies. It is well‑known that >90% of human genes undergo alternative splicing. A total of 10 distinct splicing transcripts of the BCL‑X gene have been identified, including transcript variants 1‑9 and ABALON. Different transcripts from the same gene have different functions. The present review discusses the progress in understanding the different alternative splicing transcripts of BCL‑X, including their characteristics, functions and expression patterns. The potential use of BCL‑X in targeted therapies for hematological malignancies is also discussed.

Introduction

BCL-X is a member of the BCL-2 gene family (1). The proteins in this family share homology over four conserved regions referred to as the BH1-4 domains that determine dimer formation of the proteins, as well as their function in regulating apoptosis (1) Of the four domains, the BH1, BH2 and BH3 domains facilitate the formation of a hydrophobic slit, which is involved in the uptake of the BH3 domain of pro-apoptotic proteins via heterodimerization; the BH4 domain is often absent in pro-apoptotic proteins, but present in antiapoptotic activity (2,3).

BCL-X regulates apoptosis and plays a critical role in hematopoiesis, lymphopoiesis and hematological malignancies (46). Motoyama et al (6) performed experiments in which homologous recombination was applied to knockout BCL-X. The results demonstrated that BCL-X plays a pivotal role in supporting immature lymphocytes survival. In addition, several studies have reported its key role in the lifespan of mature hematopoietic cells, including terminal differentiation stages of erythropoiesis and differentiated megakaryocytes (5,7). Mice deficient in BCL-X are anemic and develop severe thrombocytopenia (8). Deregulated expression of BCL-X function may also play a role in the pathogenesis of some hematologic disorders, particularly polycythemia vera (9).

Recently, it has been suggested that >90% of human genes undergo alternative splicing (10). Different transcripts from the same gene have the same or different expression pattern and functions (1114). Rosa et al (11) reported that six transcript variants of ZNF695 are co-expressed in cancer cell lines, and transcript variant one and three were predominantly expressed in leukemia. Handschuh et al (12) demonstrated that all three NPM1 transcripts are upregulated in leukemia compared with control samples. However, Zeilstra et al (13) reported that CD44 variant isoforms (CD44v), but not CD44s, have unique functions in promoting adenoma initiation in Apc (Min/+) mice. In addition, the H2AFY gene encodes H2A histone variant MacroH2A1, including two isoforms (MacroH2A1.1 and MacroH2A1.2) (15). MacroH2A1.1 is predominantly expressed in differentiated cells, while MacroH2A1.2 is preferentially expressed over 1.1 in proliferative cells (14). The MacroH2A1.1 isoform presents as pleiotropic tumor suppressor, by repressing cellular processes, including cell proliferation, migration and invasion, whereas the function of MacroH2A1.2 is mainly cancer-type dependent (14).

A total of 10 distinct splicing transcripts of the BCL-X gene have been identified, including transcript variants 1–9 and ABALON. The present review discusses the progress in understanding the alternative splicing transcripts of BCL-X in terms of their characteristics, functions and expression patterns. The potential use of BCL-X in targeted therapies for hematological malignancies is also discussed.

Alternative splicing of BCL-X

BCL-X, also known as BCL2L1, BCL2L and PPP1R52, is located at 20q11.21 (16,17). The BCL-X gene was first identified through a screen of the chicken lymphoid cDNA library with a probe for the BCL-2 gene at low stringency (1). The gene, such as other genes, including ZNF695, NPM1 and H2AFY, is associated with alternative splicing, and 10 transcripts have been identified to date (transcript variants 1–9 and ABALON; Fig. 1 and Table I).

Table I.

Alternative splicing transcripts of BCL-X.

Table I.

Alternative splicing transcripts of BCL-X.

ExonOpen reading frameProtein



Transcript variantAccession numberDefinitionLength (bp)No.LocationLocationLength (bp)Amino acidMolecular weight, KDName
Variant 1NM_138578.3mRNA2,574331722868-31722618, 31722348-31721655, 31666086-31664458382…108370223326 BCL-XL
Variant 3NM_001317919.2mRNA2,556331722868-31722618, 31722330-31721655, 31666086-31664458364…106570223326 BCL-XL
Variant 4NM_001317920.2mRNA2,405331723963-31723864, 31722330-31721655, 31666086-31664458213…91470223326 BCL-XL
Variant 5NM_001317921.2mRNA2,534331723963-31723735, 31722330-31721655, 31666086-31664458342…104370223326 BCL-XL
Variant 7NM_001322239.2mRNA2,423331723963-31723864, 31722348-31721655, 31666086-31664458231…93270223326 BCL-XL
Variant 8NM_001322240.2mRNA2,552331723963-31723735, 31722348-31721655, 31666086-31664458360…106170223326 BCL-XL
Variant 9NM_001322242.2mRNA2,389331722500-31722417, 31722330-31721655, 31666086-31664458197..89870223326 BCL-XL
Variant 2NM_001191.4mRNA2,385331722868-31722618, 31722348-31721844, 31666086-31664458382…89451317019 BCL-XS
Variant 6NR_134257.1Non-coding RNA2,474331722330-31721655, 31667147-31666991, 31666086-31664452NoNo
ABALONNR_131907.1Non-coding RNA1,9031 31721507-31723409NoNo

[i] NM, sequence derived from mRNA; NR, sequence derived from non-coding RNA.

Variant 1 (GenBank: NM_138578.3) represents the longest transcript, with 2,574 base pairs (bp) and contains an open reading frame (ORF, 702 bp) (Table I). It encodes a protein with 233 amino acids that displays 44% amino acid identity with human BCL-2 (1). Thus, this splicing variant encodes the longer isoform BCL-XL (B cell lymphoma-extra-large; Bcl2l1), also known as BCL-xL. Variants 3 (NM_001317919.2), 4 (NM_001317920.2), 5 (NM_001317921.2), 7 (NM_001322239.2), 8 (NM_001322240.2) and 9 (NM_001322242.2) differ from variant 1 in the 5′untranslated region, whereas their ORFs are the same as that of variant 1. Therefore, they encode the same isoform as transcript variant 1 (Table I). The ORFs and amino acid sequence of BCL-XL are presented in Table II.

Table II.

ORF and encoding amino acid sequence of BCL-X.

Table II.

ORF and encoding amino acid sequence of BCL-X.

Sequence
ORF (702 nt) ATGTCTCAGAGCAACCGGGAGCTGGTGGTTGACTTTCTCTCCTACAAGCTTTCCCAGAAAG
GATACAGCT
GGAGTCAGTTTAGTGATGTGGAAGAGAACAGGACTGAGGCCCCAGAAGGGACTGAATCGG
AGATGGAGAC
CCCCAGTGCCATCAATGGCAACCCATCCTGGCACCTGGCAGACAGCCCCGCGGTGAATGGA
GCCACTGGC
CACAGCAGCAGTTTGGATGCCCGGGAGGTGATCCCCATGGCAGCAGTAAAGCAAGCGCTGA
GGGAGGCAG
GCGACGAGTTTGAACTGCGGTACCGGCGGGCATTCAGTGACCTGACATCCCAGCTCCACATC
ACCCCAGG
GACAGCATATCAGAGCTTTGAACAGGTAGTGAATGAACTCTTCCGGGATGGGGTAAACTGGG
GTCGCATT
GTGGCCTTTTTCTCCTTCGGCGGGGCACTGTGCGTGGAAAGCGTAGACAAGGAGATGCAGGT
ATTGGTGA
GTCGGATCGCAGCTTGGATGGCCACTTACCTGAATGACCACCTAGAGCCTTGGATCCAGGAGA
ACGGCGG
CTGGGATACTTTTGTGGAACTCTATGGGAACAATGCAGCAGCCGAGAGCCGAAAGGGCCAGG
AACGCTTC
AACCGCTGGTTCCTGACGGGCATGACTGTGGCCGGCGTGGTTCTGCTGGGCTCACTCTTCAGT
CGGAAATGA
Protein (233 aa) MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAV
NGATG
HSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV
NWGRI
VAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAES
RKGQERF
NRWFLTGMTVAGVVLLGSLFSRK

[i] ORF, open reading frame; NT, nucleotide; AA, amino acid. The second coding exon of ORF are underlined. The absence of the sequence encoding the 63 amino acids of BCL-XL are indicated in bold.

Transcript variant 2 (NM_001191.4) also derives from BCL-X, with a length of 2,385 bp. Its sequence is different from that of variant 1 in the second exon, which is the result of differential usage of two 5′ splice sites within the first coding exon (Table II). This difference results in the absence of the sequence encoding the 63 amino acids of the BCL-XL ORF, which display the greatest homology to BCL-2 (1). This results in a shorter ORF with 513 bp compared with variant 1, and thus, the variant encodes a 170-amino acid protein named isoform BCL-XS (Table II).

Variant 6 (NR_134257.1) contains a different internal exon from variant 1 and is considered a non-coding RNA as use of the same 5′-most supported translational start codon found in variant 1 generates the potential for nonsense-mediated mRNA decay. Another long non-coding RNA generated by alternative splicing of the primary BCL-X RNA transcript is INXS (also named ABALON, NR_131907.1), which is 1,903 bp in length (Table I).

BCL-X can be alternatively spliced to produce 10 transcripts. Among them, seven transcripts encode the same isoform BCL-XL, whereas the transcript variant 2 translates the shorter isoform BCL-XS. Besides, two long non-coding RNAs are also generated from the gene. Currently, there are no reports on the two non-coding RNAs (variant 6 and INXS) derived from BCL-X. Thus, the present review focuses on these two splice isoforms (BCL-XL and BCL-XS).

Function of BCL-X splicing variants in hematopoietic cells

BCL-XL that inhibit apoptosis or promote compensatory proliferation

It is well-known that variants of BCL-X regulate apoptosis (2). While BCL-XL inhibits apoptosis, BCL-Xs has pro-apoptotic functions via the inhibition of BCL-2 and BCL-XL (1). BCL-XL protein binds and sequesters pro-apoptotic Bak/Bax proteins via their BH3 domains, which inactivates them (18) and prevents caspase activation (1921). This renders the cells resistant to apoptotic cell death (1,1821). However, it has been reported that BCL-XL and Bax also act independently to support cell survival, based on findings that BCL-XL can limit apoptosis independent of Bax expression, and that BCL-XL protects B cells from immunosuppressant-induced apoptosis (22). Furthermore, while BCL-XL cannot stop cell damage and cell cycle arrest induced by certain drugs, it can contribute to lower rates of cell death following drug treatment (2325).

Josefsson et al (26) demonstrated that deletion of BCL-XL leads to megakaryocyte apoptosis and failure of platelet shedding. Conversely, Kaluzhny et al (27) reported that overexpression of BCL-XL in megakaryocytes (MKs) increases the number of MKs and decreases apoptosis. In addition, BCL-XL expression is necessary for the survival of reticulocytes and MKs, and the absence of functional BCL-XL expression results in anemia and thrombocytopenia (8,2831). Dolznig et al (32) interpreted the mechanism of anemia due to loss of BCL-XL. The authors demonstrated that during erythroid maturation, erythropoietin (Epo) regulates the number of red blood cells via apoptosis inhibition arising from Epo-dependent upregulation of BCL-XL (32). Furthermore, overexpression of erythroid progenitors BCL-XL also can induce erythroid colonies without Epo (33).

Harb et al (34) reported that BCL-XL does not inhibit leukemogenesis or affect the apoptosis of tumor cells. The authors clarified the role of BCL-XL in Philadelphia chromosome-positive (Ph+) B-cell acute lymphoblastic leukemia using two mouse models, and the results demonstrated that loss of BCL-XL expression does not prohibit leukemogenesis or alter the percentage of apoptotic cells, but promotes cellular proliferation. Conversely, overexpression of BCL-XL decreases cellular proliferation. These results identified unexpected functions of BCL-XL in cell-cycle entry and tumor cell proliferation. Studies in mice lacking BCL-X expression have suggested that BCL-XL expression may be essential to the survival of proliferating hematopoietic precursor cells (6,34).

BCL-XS that promote apoptosis and are associated with BCL-XL

BCL-XS expression can block resistance to apoptosis induced by overexpression of BCL-2 (1,35). Accordingly, BCL-XS expression has been demonstrated to promote apoptosis by inhibiting the anti-apoptotic function of BCL-2 (1). Additional research demonstrating heterodimer formation between BCL-XS and BCL-XL, as well as heteromultimer formation of these proteins with BCL-2, suggested that BCL-XS play a dominant role in inactivating BCL-2 or BCL-XL (35).

Consistently, BCL-XS was recently demonstrated to limit the protective effects of BCL-XL in the contexts of growth factor withdrawal and chemotherapeutic drug treatment (36). Thus, relative expression of BCL-XS and BCL-XL may be essential in balancing cell death and survival during hematopoietic cell differentiation.

Expression and clinical significance of BCL-X splicing variants

BCL-X is differentially expressed in different differentiated hematopoietic cells and lymphoid tissues

In 1993, BCL-X mRNA expression was observed in a variety of tissues (thymus, bursa and the central nervous system), with the highest levels observed in lymphoid and the central nervous system (1). Although BCL-X mRNA expression is not observed in single-positive thymocytes or mature peripheral blood T cells, rapid induction of high levels of BCL-X mRNA expression has been observed following mitogenic activation (1). In addition, double-positive thymocytes express higher levels of BCL-XS compared with BCL-XL (1). However, Ohta et al (37) reported that the BCL-XL protein, but not the BCL-XS protein, is expressed in hematolymphoid tissue.

In 1994, Krajewski et al (38) reported the detection of BCL-X immunostaining in precursors of myeloid cells and metamyelocytes. The authors demonstrated that most bone marrow polymorphonuclear cells lack BCL-X expression along with most spleen and peripheral blood granulocytes, in accordance with other studies (37,39,40). Subsequently, Sanz et al (40) demonstrated that peripheral blood monocytes and alveolar macrophages are positive for BCL-X. In addition, BCL-X expression levels are either maintained or upregulated during monocyte/macrophage differentiation but downregulated with the maturation of myeloid progenitors into polymorphonuclear cells (40,41). Furthermore, BCL-X expression during erythropoiesis is notably increased in terminally differentiated erythroblasts (42).

Sanz et al (40) demonstrated that BCL-XL is the most highly expressed form of BCL-X in HL-60 and CD34+ cells differentiating into monocytes/macrophages. Furthermore, BCL-XL is the predominant BCL-X form expressed in peripheral blood mononuclear cells (43). However, in hematopoietic precursors, the predominant BCL-X form is BCL-XS (44). Andreeff et al (45) reported that in normal hematopoietic progenitor cells, BCL-XL is highly expressed in the earliest CD34+/33/13 compartment and to a lesser extent in CD34+/13+ cells, but is absent in promyelocytes (CD34-/33+). Furthermore, BCL-XS was detectable only in the most immature CD34+/33/13 compartment (45). In addition, BCL-XL and BCL-XS are not expressed in neutrophils (43), and the expression of BCL-XS has not been detected in erythroid cells (42).

Different expression patterns of BCL-XL and BCL-XS in hematological malignancies

BCL-XL has been detected in a variety of hemopoietic cell types, including lymphoid and myeloid leukemia lines, such as HL-60, K562, KG1a, ML-1, Molt3, Jurkat, Raji and CEM (46,47). However, BCL-XS is weakly expressed in K562 and VAL lines (lymphoid lines) (48) and not expressed in AS-E2 cells (49).

Upregulated BCL-XL expression was observed in both acute myeloid leukemia (AML) (46) and acute lymphocytic leukemia (ALL) (50). Bogenberger et al (51) measured BCL-XL expression in 577 patients with primary AML using a reverse phase protein array proteomic approach. The results demonstrated that normal CD34+ progenitor cells express less BCL-XL than most FAB classifications, and BCL-XL expression is higher in M6 compared with other AML FAB classifications (51). BCL-XL is highly expressed in leukemic CD34+/13+ or CD34-/13+ cells (44,45). Notably, the percentages of BCL-Xs positive cells among M2 and M3 types were higher than those in other types (48). Furthermore, significantly lower expression of BCL-XS was observed in CD34+ vs. CD34-leukemias (48).

In addition to acute leukemia, BCL-XL and BCL-XS have been detected in other hemopoietic diseases. For example, Gottardi et al (52) observed high BCL-XL levels during the leukemic phase in 16 of 23 B cell type chronic lymphocytic leukemia (B-CLL) cases and 8/11 mantle cell lymphoma (MCL) cases (52), while BCL-XS was observed in only low-to-trace amounts during the leukemic phase in 13/23 B-CLL cases and 6/11 of MCL cases (52). In addition, Brousset et al (53) recently reported on the frequent expression of BCL-X in Reed-Sternberg cells of 1 Hodgkin's disease. Zhang et al (41) evaluated BCL-XL expression during differentiation of megakaryocytic cells from essential thrombocythemia (ET) patients. The authors demonstrated that BCL-XL protein expression is downregulated in ET during differentiation of megakaryocytes.

Clinical significance in hematological malignancies

Expression of apoptosis-regulating protein BCL-X in AML blasts at diagnosis is associated with disease-free survival (54). Recent studies have reported that overexpression of BCL-XL leads to cellular resistance to various pharmaceutical agents, such as etoposide, doxorubicin, cisplatin, vincristine, bleomycin and paclitaxel, as well as ionizing radiation (23,50,5559). Overexpression of BCL-XL has also been associated with poor clinical outcomes in patients with AML (58). However, research indicates no gain in prognostic information from BCL-XL expression (60). Reverse transcription PCR analysis demonstrated high levels of BCL-XL mRNA in minimal residual disease (MRD) but not in normal cells (45).

Campos et al (48) revealed an inverse correlation between the percentages of BCL-2- and BCL-XS-positive cells in AML and ALL. Among the 57 patients included in the study, 37 experienced complete remission (CR), and samples from these patients contained a significantly higher percentage of BCL-XS-expressing cells compared with samples from patients who did not achieve CR (48). Notably, BCL-XS expression was observed with greater frequency in T-cell leukemias than in B-cell leukemias and was associated with a higher remission rate. Notably, for both AML and ALL, the remission rates were higher among patients with leukemic cells expressing BCL-XS (48). Cell lines hyperexpressing BCL-XS are also more sensitive to viral- or chemotherapy-induced apoptosis (61,62).

Deng et al (63) observed a higher ratio of BCL-XL to BCL-XS expression in patients with AML, with a poor prognosis (−5, −7) than those with a good prognosis [inv16, t(8;21)]. The authors reported a higher ratio of BCL-XL to BCL-XS expression in chemoresistant subtypes compared with chemosensitive subtypes (63). An increase in the ratio of BCL-XL to BCL-XS expression was also observed in MRD of AML compared with de novo diagnosed AML (45).

Therapies targeting BCL-X for hematological malignancies

The BH3 mimetics, such as ABT-199 (venetoclax), ABT-737 and ABT-263 (navitoclax), are small molecules that mimic the BH3 domains of BCL-2 family proapoptotic proteins (60,62). They have been used to bind and antagonize the functions of BCL-2 and/or BCL-XL to promote cell death in hematological malignancies (6469).

ABT-199 specifically targets BCL-2 protein and has low affinity for BCL-XL (64). Currently, ABT199 is the only US food and drug administration-approved antitumor agent targeting the BCL-2 family of proteins, and is useful for the treatment of certain hematologic malignancies, such as AML and CLL (7072). However, prolonged monotherapy tends to beget resistance to ABT-199, and the report indicated that targeting of myeloid cell leukemia-1 (MCL-1) and BCL-XL can restore sensitivity to the ABT-199 among previously resistant AML cell lines, which would delay or even prevent the development of drug resistance in these cells (73). In addition, co-expression of high BCL-2 levels with low BCL-XL levels was demonstrated to render multiple myeloma (MM) cell lines sensitive to ABT-199, whereas co-expression of BCL-2 and BCL-XL was associated with resistance to ABT-199, but sensitivity to the BCL-XL-selective inhibitor A-1155463 in MM cells (73,74).

The ABT-737 molecule has a high affinity for BCL-2, BCL-XL and BCL-W, but because it is not orally bioavailable, its administration via chronic single-agent therapy or in combination regimens is difficult (65). The orally bioavailable equivalent of ABT-737 is ABT-263 (66). ABT-263 treatment of tumor cells quickly leads to apoptosis by blocking interactions between Bcl-2/Bcl-XL and pro-death proteins, as well as by inducing Bax translocation and cytochrome c release (66). In a xenograft model of ALL, oral ABT-263 treatment alone induced complete tumor regression, and even though ABT-263 exhibited limited efficacy as a single-agent treatment in xenograft models of aggressive B-cell lymphoma and MM, it significantly enhanced the efficacies of other commonly used therapeutic regimens (63). These findings provided the necessary evidence for clinical trials of the effectiveness of ABT-263 for treating B-cell malignancies (66). Despite the promising efficacy of ABT-263 observed in preclinical studies (65,66), thrombocytopenia resulting from the inhibition of BCL-XL (a critical pro-survival factor in megakaryocytes/platelets) (75,76) is a dose-limiting toxicity for the clinical use of ABT-263 (77).

To reduce the dose-limiting platelet toxicity of ABT263, Khan et al (78) converted it to DT2216, a BCL-XL proteolysis-targeting chimera (PROTAC), that targets BCL-XL to the Von Hippel-Lindau E3 ligase, which is minimally expressed in platelets. PZ15227 is another BCL-XL PROTAC, which targets BCL-XL to the cereblon E3 ligase (79). BCL-XL PROTACs are bivalent small molecules containing a ligand that recognizes the target protein and recruit it to the E3 ligase. Target protein is polyubiquitinated and degraded in proteasome. These results confirm that BCL-XL PROTACs have improved antitumor potency and reduced platelet toxicity compared with ABT263 (78,79).

The first selective BCL-XL inhibitor, WEHI-539, was discovered via high-throughput screening and demonstrated to induce BAK-dependent apoptosis (68). Later research using fragment-based approaches led to the development of the BCL-XL antagonists A1155463 and the next-generation drug A1331852 (80). Wang et al (81) proposed that A1155463 may effectively kill ABT-199-resistant AML cells via their high expression of BCL-XL. Although preclinical studies of A1155463 and A1331852 have produced promising results, these compounds have not yet entered clinical trials (8084).

The novel BH3 domain mimetic, JY-1-106, antagonizes BCL-XL and MCL-1, and has been reported to promote cell death among HL-60 cells when administered as a single-agent treatment and in combination with retinoids (85). In addition, the greatest reduction in cell viability was observed when JY-1-106 was applied in combination with the RARγ antagonist, SR11253 (72). These findings suggest that combined administration of a dual BCL-XL/MCL-1 inhibitor with retinoids may be a promising strategy for treating leukemia (85).

Conclusion

In conclusion, 10 distinct transcripts are generated from the BCL-X gene. It encodes proteins, including BCL-XL and BCL-XS, as well as non-coding RNAs, including variant 6 and INXS. The expression patterns and functions of variant 6 and INXS remain unknown; however, studies have provided valuable insights into the expression patterns and functions of BCL-XL and BCL-XS in hematological malignancies. Therapies based on targeting BCL-X have been evaluated for their potential effectiveness against hematological malignancies, but a therapy with satisfactory clinical efficacy is yet to be discovered. Thus, continued efforts to develop better targeted therapies based on BCL-X are required.

Acknowledgements

Not applicable.

Funding

The present review was sponsored by Fujian Provincial Health Technology Project of China (grant no. 2019-2-45), the Middle-aged and Young Teachers Foundation of Fujian Educational Committee in China (grant no. JAT190835), the National Undergraduate Innovation and Entrepreneurship Training Program of China (grant no. 201912631003) and the Fujian Provincial Undergraduate Innovation and Entrepreneurship Training Program of China (grant no. 202012631031).

Availability of data and materials

Not applicable.

Authors' contributions

WC conceived the present study. WC prepared the original draft and the figure. JL performed the literature analysis. WC revised the manuscript. Data authentication is not applicable. All authors read and approved the final manuscript.

Ethics approval and consent to participate

Not applicable.

Patient consent for publication

Not applicable.

Competing interests

The authors declare that they have no competing interests.

References

1 

Boise LH, González-García M, Postema CE, Ding L, Lindsten T, Turka LA, Mao X, Nuñez G and Thompson CB: Bcl-x, a bcl-2-related gene that functions as a dominant regulator of apoptotic cell death. Cell. 74:597–608. 1993. View Article : Google Scholar : PubMed/NCBI

2 

Opferman JT: Attacking cancer's Achilles heel: Antagonism of anti-apoptotic BCL-2 family members. FEBS J. 283:2661–275. 2016. View Article : Google Scholar : PubMed/NCBI

3 

Delbridge AR and Strasser A: The BCL-2 protein family, BH3-mimetics and cancer therapy. Cell Death Differ. 22:1071–1080. 2015. View Article : Google Scholar : PubMed/NCBI

4 

Yang E and Korsmeyer SJ: Molecular thanatopsis: A discourse on the BCL2 family and cell death. Blood. 88:386–401. 1996. View Article : Google Scholar : PubMed/NCBI

5 

Motoyama N, Kimura T, Takahashi T, Watanabe T and Nakano T: Bcl-x prevents apoptotic cell death of both primitive and definitive erythrocytes at the end of maturation. J Exp Med. 189:1691–1698. 1999. View Article : Google Scholar : PubMed/NCBI

6 

Motoyama N, Wang F, Roth KA, Sawa H, Nakayama K, Nakayama K, Negishi I, Senju S, Zhang Q, Fujii S, et al: Massive cell death of immature hematopoietic cells and neurons in Bcl-x-deficient mice. Science. 267:1506–1510. 1995. View Article : Google Scholar : PubMed/NCBI

7 

Shearn AI, Deswaerte V, Gautier EL, Saint-Charles F, Pirault J, Bouchareychas L, Rucker EB III, Beliard S, Chapman J, Jessup W, et al: Bcl-x inactivation in macrophages accelerates progression of advanced atherosclerotic lesions in Apoe(−/-) mice. Arterioscler Thromb Vasc Biol. 32:1142–1149. 2012. View Article : Google Scholar : PubMed/NCBI

8 

Wagner KU, Claudio E, Rucker EB, Riedlinger G, Broussard C, Schwartzberg PL, Siebenlist U and Hennighausen L: Conditional deletion of the Bcl-x gene from erythroid cells results in hemolytic anemia and profound splenomegaly. Development. 127:4949–4958. 2000. View Article : Google Scholar : PubMed/NCBI

9 

Silva M, Richard C, Benito A, Sanz C, Olalla I and Fernández-Luna JL: Expression of Bcl-x in erythroid precursors from patients with polycythemia vera. N Engl J Med. 338:564–571. 1998. View Article : Google Scholar : PubMed/NCBI

10 

Johnson JM, Castle J, Garrett-Engele P, Kan Z, Loerch PM, Armour CD, Santos R, Schadt EE, Stoughton R and Shoemaker DD: Genome-wide survey of human alternative pre-mRNA splicing with exon junction microarrays. Science. 302:2141–2144. 2003. View Article : Google Scholar : PubMed/NCBI

11 

Rosa R, Villegas-Ruíz V, Caballero-Palacios MC, Pérez-López EI, Murata C, Zapata-Tarres M, Cárdenas-Cardos R, Paredes-Aguilera R, Rivera-Luna R and Juárez-Méndez S: Expression of ZNF695 transcript variants in childhood B-cell acute lymphoblastic leukemia. Genes (Basel). 10:7162019. View Article : Google Scholar : PubMed/NCBI

12 

Handschuh L, Wojciechowski P, Kazmierczak M, Marcinkowska-Swojak M, Luczak M, Lewandowski K, Komarnicki M, Blazewicz J, Figlerowicz M and Kozlowski P: NPM1 alternative transcripts are upregulated in acute myeloid and lymphoblastic leukemia and their expression level affects patient outcome. J Transl Med. 16:2322018. View Article : Google Scholar : PubMed/NCBI

13 

Zeilstra J, Joosten SP, van Andel H, Tolg C, Berns A, Snoek M, van de Wetering M, Spaargaren M, Clevers H and Pals ST: Stem cell CD44v isoforms promote intestinal cancer formation in Apc(min) mice downstream of Wnt signaling. Oncogene. 33:665–670. 2014. View Article : Google Scholar : PubMed/NCBI

14 

Corujo D and Buschbeck M: Post-translational modifications of H2A histone variants and their role in cancer. Cancers (Basel). 10:592018. View Article : Google Scholar : PubMed/NCBI

15 

Lee Y, Hong M, Kim JW, Hong YM, Choe YK, Chang SY, Lee KS and Choe IS: Isolation of cDNA clones encoding human histone macroH2A1 subtypes. Biochim Biophys Acta. 1399:73–77. 1998. View Article : Google Scholar : PubMed/NCBI

16 

Harder JM, Ding Q, Fernandes KA, Cherry JD, Gan L and Libby RT: BCL2L1 (BCL-X) promotes survival of adult and developing retinal ganglion cells. Mol Cell Neurosci. 51:53–59. 2012. View Article : Google Scholar : PubMed/NCBI

17 

International Stem Cell Initiative, ; Amps K, Andrews PW, Anyfantis G, Armstrong L, Avery S, Baharvand H, Baker J, Baker D, Munoz MB, et al: Screening ethnically diverse human embryonic stem cells identifies a chromosome 20 minimal amplicon conferring growth advantage. Nat Biotechnol. 29:1132–1144. 2011. View Article : Google Scholar : PubMed/NCBI

18 

Willis SN, Chen L, Dewson G, Wei A, Naik E, Fletcher JI, Adams JM and Huang DC: Proapoptotic Bak is sequestered by Mcl-1 and Bcl-xL, but not Bcl-2, until displaced by BH3-only proteins. Genes Dev. 19:1294–1305. 2005. View Article : Google Scholar : PubMed/NCBI

19 

Kluck RM, Bossy-Wetzel E, Green DR and Newmeyer DD: The release of cytochrome c from mitochondria: A primary site for Bcl-2 regulation of apoptosis. Science. 275:1132–1136. 1997. View Article : Google Scholar : PubMed/NCBI

20 

Kim CN, Wang X, Huang Y, Ibrado AM, Liu L, Fang G and Bhalla K: Overexpression of Bcl-X(L) inhibits Ara-C-induced mitochondrial loss of cytochrome c and other perturbations that activate the molecular cascade of apoptosis. Cancer Res. 57:3115–3120. 1997.PubMed/NCBI

21 

Yang J, Liu X, Bhalla K, Kim CN, Ibrado AM, Cai J, Peng TI, Jones DP and Wang X: Prevention of apoptosis by Bcl-2: Release of cytochrome c from mitochondria blocked. Science. 275:1129–1132. 1997. View Article : Google Scholar : PubMed/NCBI

22 

Gottschalk AR, Boise LH, Thompson CB and Quintáns J: Identification of immunosuppressant-induced apoptosis in a murine B-cell line and its prevention by bcl-x but not bcl-2. Proc Natl Acad Sci USA. 91:7350–7354. 1994. View Article : Google Scholar : PubMed/NCBI

23 

Minn AJ, Rudin CM, Boise LH and Thompson CB: Expression of bcl-xL can confer a multidrug resistance phenotype. Blood. 86:1903–1910. 1995. View Article : Google Scholar : PubMed/NCBI

24 

Kamesaki S, Kamesaki H, Jorgensen TJ, Tanizawa A, Pommier Y and Cossman J: Bcl-2 protein inhibits etoposide-induced apoptosis through its effects on events subsequent to topoisomerase II-induced DNA strand breaks and their repair. Cancer Res. 53:4251–4256. 1993.PubMed/NCBI

25 

Walton MI, Whysong D, O'Connor PM, Hockenbery D, Korsmeyer SJ and Kohn KW: Constitutive expression of human Bcl-2 modulates nitrogen mustard and camptothecin induced apoptosis. Cancer Res. 53:1853–1861. 1993.PubMed/NCBI

26 

Josefsson EC, James C, Henley KJ, Debrincat MA, Rogers KL, Dowling MR, White MJ, Kruse EA, Lane RM, Ellis S, et al: Megakaryocytes possess a functional intrinsic apoptosis pathway that must be restrained to survive and produce platelets. J Exp Med. 208:2017–2031. 2011. View Article : Google Scholar : PubMed/NCBI

27 

Kaluzhny Y, Yu G, Sun S, Toselli PA, Nieswandt B, Jackson CW and Ravid K: Bcl-xL overexpression in megakaryocytes leads to impaired platelet fragmentation. Blood. 100:1670–1678. 2002. View Article : Google Scholar : PubMed/NCBI

28 

Delbridge AR, Aubrey BJ, Hyland C, Bernardini JP, Di Rago L, Garnier JM, Lessene G, Strasser A, Alexander WS and Grabow S: The BH3-only proteins BIM and PUMA are not critical for the reticulocyte apoptosis caused by loss of the pro-survival protein BCL-XL. Cell Death Dis. 8:e29142017. View Article : Google Scholar : PubMed/NCBI

29 

Afreen S, Bohler S, Müller A, Demmerath EM, Weiss JM, Jutzi JS, Schachtrup K, Kunze M and Erlacher M: BCL-XL expression is essential for human erythropoiesis and engraftment of hematopoietic stem cells. Cell Death Dis. 11:82020. View Article : Google Scholar : PubMed/NCBI

30 

Hafid-Medheb K, Augery-Bourget Y, Minatchy MN, Hanania N and Robert-Lézénès J: Bcl-XL is required for heme synthesis during the chemical induction of erythroid differentiation of murine erythroleukemia cells independently of its antiapoptotic function. Blood. 101:2575–2583. 2003. View Article : Google Scholar : PubMed/NCBI

31 

Mason KD, Carpinelli MR, Fletcher JI, Collinge JE, Hilton AA, Ellis S, Kelly PN, Ekert PG, Metcalf D, Roberts AW, et al: Programmed anuclear cell death delimits platelet life span. Cell. 128:1173–1186. 2007. View Article : Google Scholar : PubMed/NCBI

32 

Dolznig H, Habermann B, Stangl K, Deiner EM, Moriggl R, Beug H and Müllner EW: Apoptosis protection by the Epo target Bcl-X(L) allows factor-independent differentiation of primary erythroblasts. Curr Biol. 12:1076–1085. 2002. View Article : Google Scholar : PubMed/NCBI

33 

Garçon L, Rivat C, James C, Lacout C, Camara-Clayette V, Ugo V, Lecluse Y, Bennaceur-Griscelli A and Vainchenker W: Constitutive activation of STAT5 and Bcl-xL overexpression can induce endogenous erythroid colony formation in human primary cells. Blood. 108:1551–154. 2006. View Article : Google Scholar

34 

Harb JG, Chyla BI and Huettner CS: Loss of Bcl-x in Ph+ B-ALL increases cellular proliferation and does not inhibit leukemogenesis. Blood. 111:3760–3769. 2008. View Article : Google Scholar : PubMed/NCBI

35 

Sato T, Hanada M, Bodrug S, Irie S, Iwama N, Boise LH, Thompson CB, Golemis E, Fong L, Wang HG, et al: Interactions among members of the Bcl-2 protein family analyzed with a yeast two-hybrid system. Proc Natl Acad Sci USA. 91:9238–9242. 1994. View Article : Google Scholar : PubMed/NCBI

36 

Minn AJ, Boise LH and Thompson CB: Bcl-x(S) anatagonizes the protective effects of Bcl-x(L). J Biol Chem. 271:6306–6312. 1996. View Article : Google Scholar : PubMed/NCBI

37 

Ohta K, Iwai K, Kasahara Y, Taniguchi N, Krajewski S, Reed JC and Miyawaki T: Immunoblot analysis of cellular expression of Bcl-2 family proteins, Bcl-2, Bax, Bcl-X and Mcl-1, in human peripheral blood and lymphoid tissues. Int Immunol. 7:1817–1825. 1995. View Article : Google Scholar : PubMed/NCBI

38 

Krajewski S, Krajewska M, Shabaik A, Wang HG, Irie S, Fong L and Reed JC: Immunohistochemical analysis of in vivo patterns of Bcl-X expression. Cancer Res. 54:5501–5507. 1994.PubMed/NCBI

39 

Liles WC and Klebanoff SJ: Regulation of apoptosis in neutrophils-Fas track to death. J Immunol. 155:3289–3291. 1995.PubMed/NCBI

40 

Sanz C, Benito A, Silva M, Albella B, Richard C, Segovia JC, Insunza A, Bueren JA and Fernández-Luna JL: The expression of Bcl-x is downregulated during differentiation of human hematopoietic progenitor cells along the granulocyte but not the monocyte/macrophage lineage. Blood. 89:3199–3204. 1997. View Article : Google Scholar : PubMed/NCBI

41 

Zhang L, Zhao H, Sun A, Lu S, Liu B, Tang F, Feng Y, Zhao L, Yang R and Han ZC: Early down-regulation of Bcl-xL expression during megakaryocytic differentiation of thrombopoietin-induced CD34+ bone marrow cells in essential thrombocythemia. Haematologica. 89:1199–1206. 2004.PubMed/NCBI

42 

Gregoli PA and Bondurant MC: The roles of Bcl-X(L) and apopain in the control of erythropoiesis by erythropoietin. Blood. 90:630–640. 1997. View Article : Google Scholar : PubMed/NCBI

43 

Moulding DA, Quayle JA, Hart CA and Edwards SW: Mcl-1 expression in human neutrophils: Regulation by cytokines and correlation with cell survival. Blood. 92:2495–2502. 1998. View Article : Google Scholar : PubMed/NCBI

44 

Park JR, Bernstein ID and Hockenbery DM: Primitive human hematopoietic precursors express Bcl-x but not Bcl-2. Blood. 86:868–876. 1995. View Article : Google Scholar : PubMed/NCBI

45 

Andreeff M, Jiang S, Zhang X, Konopleva M, Estrov Z, Snell VE, Xie Z, Okcu MF, Sanchez-Williams G, Dong J, et al: Expression of Bcl-2-related genes in normal and AML progenitors: Changes induced by chemotherapy and retinoic acid. Leukemia. 13:1881–1892. 1999. View Article : Google Scholar : PubMed/NCBI

46 

Kaufmann SH, Karp JE, Svingen PA, Krajewski S, Burke PJ, Gore SD and Reed JC: Elevated expression of the apoptotic regulator Mcl-1 at the time of leukemic relapse. Blood. 91:991–1000. 1998. View Article : Google Scholar : PubMed/NCBI

47 

Lotem J and Sachs L: Regulation of bcl-2, bcl-XL and bax in the control of apoptosis by hematopoietic cytokines and dexamethasone. Cell Growth Differ. 6:647–653. 1995.PubMed/NCBI

48 

Campos L, Sabido O, Viallet A, Vasselon C and Guyotat D: Expression of apoptosis-controlling proteins in acute leukemia cells. Leuk Lymphoma. 33:499–509. 1999. View Article : Google Scholar : PubMed/NCBI

49 

Tsushima H, Urata Y, Miyazaki Y, Fuchigami K, Kuriyama K, Kondo T and Tomonaga M: Human erythropoietin receptor increases GATA-2 and Bcl-xL by a protein kinase C-dependent pathway in human erythropoietin-dependent cell line AS-E2. Cell Growth Differ. 8:1317–1328. 1997.PubMed/NCBI

50 

Findley HW, Gu L, Yeager AM and Zhou M: Expression and regulation of Bcl-2, Bcl-xl, and Bax correlate with p53 status and sensitivity to apoptosis in childhood acute lymphoblastic leukemia. Blood. 89:2986–2993. 1997. View Article : Google Scholar : PubMed/NCBI

51 

Bogenberger JM, Kornblau SM, Pierceall WE, Lena R, Chow D, Shi CX, Mantei J, Ahmann G, Gonzales IM, Choudhary A, et al: BCL-2 family proteins as 5-Azacytidine-sensitizing targets and determinants of response in myeloid malignancies. Leukemia. 28:1657–1665. 2014. View Article : Google Scholar : PubMed/NCBI

52 

Gottardi D, Alfarano A, De Leo AM, Stacchini A, Aragno M, Rigo A, Veneri D, Zanotti R, Pizzolo G and Caligaris-Cappio F: In leukaemic CD5+ B cells the expression of BCL-2 gene family is shifted toward protection from apoptosis. Br J Haematol. 94:612–618. 1996. View Article : Google Scholar : PubMed/NCBI

53 

Brousset P, Benharroch D, Krajewski S, Laurent G, Meggetto F, Rigal-Huguet F, Gopas J, Prinsloo I, Pris J, Delsol G, et al: Frequent expression of the cell death-inducing gene Bax in Reed-Sternberg cells of Hodgkin's disease. Blood. 87:2470–2475. 1996. View Article : Google Scholar : PubMed/NCBI

54 

Wojtuszkiewicz A, Schuurhuis GJ, Kessler FL, Piersma SR, Knol JC, Pham TV, Jansen G, Musters RJ, van Meerloo J, Assaraf YG, et al: Exosomes secreted by apoptosis-resistant acute myeloid leukemia (AML) blasts harbor regulatory network proteins potentially involved in antagonism of apoptosis. Mol Cell Proteomics. 15:1281–1298. 2016. View Article : Google Scholar : PubMed/NCBI

55 

Datta R, Manome Y, Taneja N, Boise LH, Weichselbaum R, Thompson CB, Slapak CA and Kufe D: Overexpression of Bcl-XL by cytotoxic drug exposure confers resistance to ionizing radiation-induced internucleosomal DNA fragmentation. Cell Growth Differ. 6:363–370. 1995.PubMed/NCBI

56 

Ibrado AM, Huang Y, Fang G and Bhalla K: Bcl-xL overexpression inhibits taxol-induced Yama protease activity and apoptosis. Cell Growth Differ. 7:1087–1094. 1996.PubMed/NCBI

57 

Ibrado AM, Huang Y, Fang G, Liu L and Bhalla K: Overexpression of Bcl-2 or Bcl-xL inhibits Ara-C-induced CPP32/Yama protease activity and apoptosis of human acute myelogenous leukemia HL-60 cells. Cancer Res. 56:4743–4748. 1996.PubMed/NCBI

58 

Xie C, Edwards H, Caldwell JT, Wang G, Taub JW and Ge Y: Obatoclax potentiates the cytotoxic effect of cytarabine on acute myeloid leukemia cells by enhancing DNA damage. Mol Oncol. 9:409–421. 2015. View Article : Google Scholar : PubMed/NCBI

59 

Huang Y, Ibrado AM, Reed JC, Bullock G, Ray S, Tang C and Bhalla K: Co-expression of several molecular mechanisms of multidrug resistance and their significance for paclitaxel cytotoxicity in human AML HL-60 cells. Leukemia. 11:253–257. 1997. View Article : Google Scholar : PubMed/NCBI

60 

Salomons GS, Smets LA, Verwijs-Janssen M, Hart AA, Haarman EG, Kaspers GJ, Wering EV, Der Does-Van Den Berg AV and Kamps WA: Bcl-2 family members in childhood acute lymphoblastic leukemia: Relationships with features at presentation, in vitro and in vivo drug response and long-term clinical outcome. Leukemia. 13:1574–1580. 1999. View Article : Google Scholar : PubMed/NCBI

61 

Dole MG, Clarke MF, Holman P, Benedict M, Lu J, Jasty R, Eipers P, Thompson CB, Rode C, Bloch C, et al: Bcl-xS enhances adenoviral vector-induced apoptosis in neuroblastoma cells. Cancer Res. 56:5734–5740. 1996.PubMed/NCBI

62 

Sumantran VN, Ealovega MW, Nuñez G, Clarke MF and Wicha MS: Overexpression of Bcl-XS sensitizes MCF-7 cells to chemotherapy-induced apoptosis. Cancer Res. 55:2507–2510. 1995.PubMed/NCBI

63 

Deng G, Lane C, Kornblau S, Goodacre A, Snell V, Andreeff M and Deisseroth AB: Ratio of bcl-xshort to bcl-xlong is different in good- and poor-prognosis subsets of acute myeloid leukemia. Mol Med. 4:158–164. 1998. View Article : Google Scholar : PubMed/NCBI

64 

Souers AJ, Leverson JD, Boghaert ER, Ackler SL, Catron ND, Chen J, Dayton BD, Ding H, Enschede SH, Fairbrother WJ, et al: ABT-199, a potent and selective BCL-2 inhibitor, achieves antitumor activity while sparing platelets. Nat Med. 19:202–208. 2013. View Article : Google Scholar : PubMed/NCBI

65 

Oltersdorf T, Elmore SW, Shoemaker AR, Armstrong RC, Augeri DJ, Belli BA, Bruncko M, Deckwerth TL, Dinges J, Hajduk PJ, et al: An inhibitor of Bcl-2 family proteins induces regression of solid tumours. Nature. 435:677–681. 2005. View Article : Google Scholar : PubMed/NCBI

66 

Tse C, Shoemaker AR, Adickes J, Anderson MG, Chen J, Jin S, Johnson EF, Marsh KC, Mitten MJ, Nimmer P, et al: ABT-263: A potent and orally bioavailable Bcl-2 family inhibitor. Cancer Res. 68:3421–3428. 2008. View Article : Google Scholar : PubMed/NCBI

67 

Jilg S, Reidel V, Müller-Thomas C, König J, Schauwecker J, Höckendorf U, Huberle C, Gorka O, Schmidt B, Burgkart R, et al: Blockade of BCL-2 proteins efficiently induces apoptosis in progenitor cells of high-risk myelodysplastic syndromes patients. Leukemia. 30:112–123. 2016. View Article : Google Scholar : PubMed/NCBI

68 

Lessene G, Czabotar PE, Sleebs BE, Zobel K, Lowes KN, Adams JM, Baell JB, Colman PM, Deshayes K, Fairbrother WJ, et al: Structure-guided design of a selective BCL-X(L) inhibitor. Nat Chem Biol. 9:390–397. 2013. View Article : Google Scholar : PubMed/NCBI

69 

Sleebs BE, Kersten WJ, Kulasegaram S, Nikolakopoulos G, Hatzis E, Moss RM, Parisot JP, Yang H, Czabotar PE, Fairlie WD, et al: Discovery of potent and selective benzothiazole hydrazone inhibitors of Bcl-XL. J Med Chem. 56:5514–5540. 2013. View Article : Google Scholar : PubMed/NCBI

70 

Konopleva M, Pollyea DA, Potluri J, Chyla B, Hogdal L, Busman T, McKeegan E, Salem AH, Zhu M, Ricker JL, et al: Efficacy and biological correlates of response in a phase II study of venetoclax monotherapy in patients with acute myelogenous leukemia. Cancer Discov. 6:1106–1117. 2016. View Article : Google Scholar : PubMed/NCBI

71 

Roberts AW, Davids MS, Pagel JM, Kahl BS, Puvvada SD, Gerecitano JF, Kipps TJ, Anderson MA, Brown JR, Gressick L, et al: Targeting BCL2 with venetoclax in relapsed chronic lymphocytic leukemia. N Engl J Med. 374:311–322. 2016. View Article : Google Scholar : PubMed/NCBI

72 

Stilgenbauer S, Eichhorst B, Schetelig J, Coutre S, Seymour JF, Munir T, Puvvada SD, Wendtner CM, Roberts AW, Jurczak W, et al: Venetoclax in relapsed or refractory chronic lymphocytic leukaemia with 17p deletion: A multicentre, open-label, phase 2 study. Lancet Oncol. 17:768–778. 2016. View Article : Google Scholar : PubMed/NCBI

73 

Lin KH, Winter PS, Xie A, Roth C, Martz CA, Stein EM, Anderson GR, Tingley JP and Wood KC: Targeting MCL-1/BCL-XL forestalls the acquisition of resistance to ABT-199 in acute myeloid leukemia. Sci Rep. 6:276962016. View Article : Google Scholar : PubMed/NCBI

74 

Punnoose EA, Leverson JD, Peale F, Boghaert ER, Belmont LD, Tan N, Young A, Mitten M, Ingalla E, Darbonne WC, et al: Expression profile of BCL-2, BCL-XL, and MCL-1 predicts pharmacological response to the BCL-2 selective antagonist venetoclax in multiple myeloma models. Mol Cancer Ther. 15:1132–1144. 2016. View Article : Google Scholar : PubMed/NCBI

75 

Schoenwaelder SM, Jarman KE, Gardiner EE, Hua M, Qiao J, White MJ, Josefsson EC, Alwis I, Ono A, Willcox A, et al: Bcl-xL-inhibitory BH3 mimetics can induce a transient thrombocytopathy that undermines the hemostatic function of platelets. Blood. 118:1663–1674. 2011. View Article : Google Scholar : PubMed/NCBI

76 

Kile BT: The role of apoptosis in megakaryocytes and platelets. Br J Haematol. 165:217–226. 2014. View Article : Google Scholar : PubMed/NCBI

77 

Roberts AW, Seymour JF, Brown JR, Wierda WG, Kipps TJ, Khaw SL, Carney DA, He SZ, Huang DC, Xiong H, et al: Substantial susceptibility of chronic lymphocytic leukemia to BCL2 inhibition: Results of a phase I study of navitoclax in patients with relapsed or refractory disease. J Clin Oncol. 30:488–496. 2012. View Article : Google Scholar : PubMed/NCBI

78 

Khan S, Zhang X, Lv D, Zhang Q, He Y, Zhang P, Liu X, Thummuri D, Yuan Y, Wiegand JS, et al: A selective BCL-XL PROTAC degrader achieves safe and potent antitumor activity. Nat Med. 25:1938–1947. 2019. View Article : Google Scholar : PubMed/NCBI

79 

He Y, Zhang X, Chang J, Kim HN, Zhang P, Wang Y, Khan S, Liu X, Zhang X, Lv D, et al: Using proteolysis-targeting chimera technology to reduce navitoclax platelet toxicity and improve its senolytic activity. Nat Commun. 11:19962020. View Article : Google Scholar : PubMed/NCBI

80 

Tao ZF, Hasvold L, Wang L, Wang X, Petros AM, Park CH, Boghaert ER, Catron ND, Chen J, Colman PM, Czabotar PE, et al: Discovery of a potent and selective BCL-XL inhibitor with in vivo activity. ACS Med Chem Lett. 5:1088–1093. 2014. View Article : Google Scholar : PubMed/NCBI

81 

Wang Q, Wan J, Zhang W and Hao S: MCL-1 or BCL-xL-dependent resistance to the BCL-2 antagonist (ABT-199) can be overcome by specific inhibitor as single agents and in combination with ABT-199 in acute myeloid leukemia cells. Leuk Lymphoma. 60:2170–2180. 2019. View Article : Google Scholar : PubMed/NCBI

82 

Zhu Y, Doornebal EJ, Pirtskhalava T, Giorgadze N, Wentworth M, Fuhrmann-Stroissnigg H, Niedernhofer LJ, Robbins PD, Tchkonia T and Kirkland JL: New agents that target senescent cells: The flavone, fisetin, and the BCL-XL inhibitors, A1331852 and A1155463. Aging (Albany NY). 9:955–963. 2017. View Article : Google Scholar : PubMed/NCBI

83 

Wang L, Doherty GA, Judd AS, Tao ZF, Hansen TM, Frey RR, Song X, Bruncko M, Kunzer AR, Wang X, et al: Discovery of A-1331852, a First-in-Class, potent, and orally-bioavailable BCL-XL inhibitor. ACS Med Chem Lett. 11:1829–1836. 2020. View Article : Google Scholar : PubMed/NCBI

84 

Kirkland JL and Tchkonia T: Cellular senescence: A translational perspective. EBioMedicine. 21:21–28. 2017. View Article : Google Scholar : PubMed/NCBI

85 

Perri M, Yap JL, Yu J, Cione E, Fletcher S and Kane MA: BCL-xL/MCL-1 inhibition and RARγ antagonism work cooperatively in human HL60 leukemia cells. Exp Cell Res. 327:183–191. 2014. View Article : Google Scholar : PubMed/NCBI

Related Articles

Journal Cover

September-2021
Volume 22 Issue 3

Print ISSN: 1792-1074
Online ISSN:1792-1082

Sign up for eToc alerts

Recommend to Library

Copy and paste a formatted citation
x
Spandidos Publications style
Chen W and Li J: Alternative splicing of BCL‑X and implications for treating hematological malignancies (Review). Oncol Lett 22: 670, 2021.
APA
Chen, W., & Li, J. (2021). Alternative splicing of BCL‑X and implications for treating hematological malignancies (Review). Oncology Letters, 22, 670. https://doi.org/10.3892/ol.2021.12931
MLA
Chen, W., Li, J."Alternative splicing of BCL‑X and implications for treating hematological malignancies (Review)". Oncology Letters 22.3 (2021): 670.
Chicago
Chen, W., Li, J."Alternative splicing of BCL‑X and implications for treating hematological malignancies (Review)". Oncology Letters 22, no. 3 (2021): 670. https://doi.org/10.3892/ol.2021.12931